실험실에서 수행 된 연구 활동은 연구 재단의 보조금에 의해 지원되었다 - 플랑드르 (FWO, 부여 번호 G.0545.08 및 G.0298.11) Interuniversity 장르 폴란드 프로그램 (벨기에 과학 정책, 허가 번호 P6/28 및 P7/13) 그리고 FWO 지원 연구 커뮤니티에 포함됩니다. 플랑드르 (FWO) - CDH는 연구 재단의 박사후 사람입니다. 저자는 매우 분자 및 세포 신호 (KU 루벤), 박사 SP 스 리니 (시력 측정법의 인디애나 대학 학교, USA) 박사 Leybaert의 연구실 (겐트 대학교)의 연구소의 모든 현재 및 이전 회원들에게 감사와 있습니다 도움이 토론을 제공하는 박사 Vinken은 (VUB), 절차를 최적화하거나 넥신 hemichannels의 연구 도구의 개발에 참여했다.

1. 각막 내피 세포의 분리 시작하기 전에 : 눈 enucleating 후 현지 도축장, 가능한 한 빨리 얻은 신선한 눈에서 세포를 분리. 눈이 최대 18 개월 5 분 사후과 얼의 균형 소금 용액에 보존의 소에서 적출되었는지 확인 - 4의 1 % 요오드 용액 실험실 운송 ° C. <ol><li> 얼의 균형 소금 솔루션의 밖으로 눈을 가지고 - 1 % 요오드 용액을 페트리 접시 (100 X 20mm)에 넣습니다. </li><li> 70 % 에탄올을 포함하는 용액으로 눈을 소독하고 1 % 요오드를 포함 얼의 균형 소금 용액으로 씻어. </li><li> 에서이 단계에서, 멸균 후드에서 작동합니다. 조심스럽게 눈에서 각막을 해부하고 위로 향하게 상피 세포 층과 얼의 균형 소금 솔루션을 포함하는 페트리 접시 (35 × 10 ㎜)에 배치합니다. 주의 깊게 남아있는 홍채 조직 STI를 제거필요한 경우 각막에 부착 것이다. </li><li> 위로 내피 세포의 레이어와 페트리 접시를 포함하는 다른 얼의 균형 소금 솔루션에 각막을 전송하고 얼의 균형 소금 용액으로 두 번 헹구십시오. </li><li> 컵 모양의 접시입니다 모래에 위로 향하게 내피 층 각막을 전송하고, 성장 매체로 커버. 성장 매체는 25 mM의 포도당, 10 % 소 태아 혈청, 6.6 % L-글루타민, 2.5 ㎍ / ㎖ 암포 테리 신-B, 1 % 항생제 항진균 혼합물을 10,000 단위를 포함하는 / 페니실린의 ML, 10,000 μg을 함유 Dulbecco의 수정 이글의 중간으로 구성 스트렙토 마이신 / ㎖, 25 ㎍ / ㎖ 암포 테리 신 B. </li><li> 흡입 피펫 매체를 제거합니다. </li><li> 각막의 내피 층 (트립신을 포함하는 모든 단계가 같은 농도를 사용하여 수행 할 수 있습니다)에 트립신 용액 (0.5 g / L)의 300 μl를 적용합니다. </li><li> 적용 페트리 접시에 각막을 포함하는 모래 시계를 놓고 INC에 넣어37 30 분 동안 ubator ° C와 5 % CO 2. </li><li> 부드럽게 멸균 후드에 불 세련된 후크 모양의 유리 파스퇴르 피펫으로 각막에서 멀리 내피 세포를 긁어. </li><li> 내피 세포를 포함하는 솔루션을 빨아 문화 매체의 4 ML을 포함하는 문화 플라스크 (25cm 2)에 추가합니다. </li><li> 각막에 성장 매체 300 μl를 적용하고 긁기를 반복하고 문화 플라스크에 내피 세포가 포함 된 솔루션을 추가합니다. </li><li> 한 번 더 마지막 단계 (1.11)를 반복합니다. </li><li> 문화를 놓고 37 배양기에서 배양 배지 ° C와 5 % CO 2에서 각막 내피 세포를 포함 플라스 크입니다. </li><li> 이틀, 문화 매체의 10 ML을 추가합니다. </li><li> 격일로 성장 매체를 새로 고칩니다. </li></ol> 2. 세포 배양 <ol><li> 배지를 제거하고 도달 자랄 얼의 균형 소금 솔루션 (이란게 내에서 두 번 세포를 씻으분리 후 T는 10 일). </li><li> 를 분리하고 인큐베이터에 플라스크를 배치 할 셀에 1.5 ML 트립신 솔루션을 추가 (37 ° C, 5 % CO 2) 3-4 분. </li><li> 성장 매체 12 ML을 추가합니다. 세포를 분산하고 세포를 계산하기 위해 밖으로 중간 세 번 피펫. </li><li> 세포 밀도와 인큐베이터에 넣어 따라 변수 부분에 씨앗 세포를. 165,000 세포의 세포 수 (cm 2 당 세포 밀도 39,286) 두 잘 챔버 슬라이드 (4.2 cm 2의 면적)를 준비. cm 2 당 6,250의 밀도에 새로운 통과를 위해 80cm 2 문화 플라스크를 준비하고 25 ML의 총 볼륨에 신선한 문화 매체를 추가 할 수 있습니다. </li><li> 이틀 매체를 새로 고칩니다. </li><li> 세포 층 자랄는 3-4일에 도달 한 후에. 실험 세포를 사용합니다. </li><li> 플라스크의 세포 층의 confluency에 도달하면, 2.6 단계 2.1를 반복합니다. 통행 최대 2 세포 배양 F를 사용할 수 있습니다또는 실험. </li></ol> 3. 유도 칼슘 웨이브 기계적 자극 <ol><li> 10 μM 플루오-4와 챔버 슬라이드에 세포를로드하기에 오전 37시 30 분 생리 인산염 버퍼 ° C 가볍게 흔들어. </li><li> 플루오-4 솔루션 AM 제거, 생리 인산염 버퍼와 세포 다섯 번 씻어 염분 인산 버퍼로 세포를 배양 및 측정 전에 실온에서 적어도 5 분 동안 세포를 둡니다. </li><li> 아르곤 레이저를 사용 빔 스플리터 HFT 488와 488 nm에서 흥분은 longpass 방출 필터 LP 505를 사용하여 530 nm에서 형광 방출을 수집 최소한 핀홀을 설정합니다. 기름 침지 40X 목표 (공기, 1.2 NA)를 사용합니다. ARL-67156를 가진 실험에서 10X 목표를 사용 (공기, 0.3 NA). </li><li> 세포가 공 촛점 현미경에 합류되는 필드를 검색합니다. </li><li> 위치는 45 챔버 슬라이드에 대하여 10 °와 세포막을 터치에서되도록 피펫을.하나의 셀에 짧은 (≈ 1 초) 기계적 자극을 자극. 기계적 자극 잠깐입니다 앰프를 통해 운영 압전 크리스탈 나노 위치에 결합 된 유리 마이크로 피펫 (팁 직경 &lt;1 ㎛)로 세포막의 1 % 미만을 만져 세포의 급성, 짧은 지속 변형으로 구성 마이크로 매니퓰레이터에 장착. 유리 마이크로 피펫을 미세 전극 풀러와 함께 만들어집니다. 나노 위치가 기계적 자극하는 동안 0.2에서 1.5 V 사이의 전압으로 작동되어 있는지 확인합니다. 1.5 V보다 높은 전압 세포가 손상 될 수 있습니다. 각 세포 유형 및 조건, 세포 손상없이 기계적 자극에 대한 최적의 전압은 신중하게 높은 (1.5 V) 전압 (0.2 V)에서부터 시작 전압의 시리즈를 적용하여 결정해야합니다. 이 전압이 세포막에 적용되는 기계적 응력과 변형을 결정 때문에 전압은 자극의 힘에 대한 척도이다.기계적 자극의 힘은 지역에 기계적 스트레스를 곱하여 계산할 수 있습니다. 면적 (&lt;3.14 μm의 2) 및 기계적 스트레스가 모두 매우 낮은이기 때문에, 기계적 자극의 힘은 낮다. (세포가 손상되었을 때, 세포와 세포 밖으로 형광 누출이 어두워합니다.) </li><li> 공간적 변화를 측정 [칼슘 2 +] 공 촛점 현미경으로 기계적 자극에 따라 전. </li><li> 이미지를 수집하고 저장합니다. </li><li> 공 초점 현미경의 소프트웨어를 사용하여 반응 세포 (활성 영역, AA)의 총 면적을 정의하는 관심 다각형 영역을 그립니다. </li></ol>

저자는 공개 아무것도 없어.

이 논문에서, 우리는 마이크로 피펫을 사용하여 지역화 및 제어 기계 자극을 제공함으로써 주 소 각막 내피 세포의 단일 층에 간 칼슘 2 + 파 전파를 측정하는 간단한 방법을 설명합니다. 기계적 자극 세포는 +, 둘은 간 칼슘 2 + 파 전파 11,67 운전 필수적인 세포 내 신호 전달 분자 세포 내 IP 3 칼슘 2 지역의 증가와 함께 응답합니다. 칼슘 2 + hemichannels의 개방과 G-단백질 결합 P2의 활성화를 통해 이웃 세포에서 칼슘 2 + 신호를 트리거 ATP 68,69의 방출을 유발하면서 IP 3 직접 갭 접합 채널 5를 통해 이웃 세포에 전달된다 수용체 37-40. 갭 접합 채널이 과정에서 hemichannels의 상대적 기여도는 CX-모방의 사용에 의해 특징 지어 질 수있다펩티드, ATP-분해 효소 (ectonucleotidases)와 ectonucleotisdases의 억제. 소 각막 내피 세포의 기계적 자극에 의한 세포 내 칼슘 2 + 파 전파의 성질은 충분히 우리가 실험실 25-33 특징으로하고 있습니다. 우리의 결과는 간 칼슘 2 + 파의 전파는 주로 눈에 띄는 역할을 Cx43과 ATP의 CX-hemichannel 매개 릴리스에 의해 구동됩니다 것을 나타냅니다. 따라서, 기본 소 각막 내피 세포에 적용이 메소드는 기본 세포에서 내인성 수준에서 Cx43 hemichannels의 규정을 확인하거나 특성에 특히 적합합니다. 이 방법을 사용하여, 우리는 Cx43 hemichannels의 활동이 매우 액토 마이 오신의 내생 브레이크 과도한 방지 역할을 할 수 뼈대, 따라서 해로운, Cx43 hemichannel 오프닝 25,31,32에 의해 제어되는 것으로 나타났습니다. 우리는 더 이상이 규정의 근간이되는 분자 메커니즘을 해명 찾아Cx43 hemichannels (33)의 개방에 필수적인 분자 루프 / 테일 상호 작용의 중요한 역할. 분명히,이 시스템은 CX는과 Panx 기반의 갭 접합 채널 hemichannels의 기능을 연구에 매우 적합 확실히 소 각막 내피 세포에 국한되지 않고 거의 모든 세포 유형도 복잡한 조직에 적응할과 같이되었습니다 기계적 자극이 큰 간 칼슘 2 + - 파도 전체 반구를 포괄하는 70 트리거 뇌합니다. 다른 도구는 CX-모방 펩타이드, ATP-분해 효소, ectonucleotidases의 억제제 carbenoxolone 10 Panx1 (표 2) 49,50과 같은 약물 화합물 등 간격 접합 채널과 hemichannels의 공헌을 평가하기 위해 존재한다. 이 과정에서 특정 CX는 나 Panx 이소의 기여를 결정주의 깊게 디자인의 siRNA 프로브 t의 mRNA와 스크램블 제어의 두 개의 독립적 인 영역을 argeting하여 사용되어야한다. 최저의 범위는 서양 블롯 분석 및 형광 현미경을 사용하여 단일 세포 수준을 사용하여 총 단백질 수준에서 결정되어야한다. 실험 세포 단일 층에서의 siRNA 프로브의 형질 효율은 형광 현미경에 의해 평가되어야한다. 이를 위해, 하나는 형광 라벨이 감지 가닥의 3 &#39;말단에 통합되었습니다하는 이중의 siRNA를 개발할 수 있습니다. 그것은주의하는 것이 중요합니다 적절한 분석을 위해, CX는 또는 Panx 이소 (&gt; 90 % 감소)의 눈에 띄는 감소뿐만 아니라, 세포 단일 층에서의 siRNA 쌍신 (&gt; 세포의 90 %는 siRNA를 형질 전환의 균일 한 형질 프로브)를 취득해야합니다. 대상으로 설계의 siRNA 프로브의 선택은 71 평가되어야한다. 즉, 이러한 도구들은 다른 CX는 나 Panx의 아형이나 다른 주요 컴의 발현에 영향을 미치지 않도록 유효성을 검사해야간 칼슘을 구동 ponents + - 파도 P2X 또는 P2Y 수용체처럼. Cx43 hemichannels의 기여를 평가하기 위해, 우리의 선택, 강력한 억제제 역할을 Cx43 (TAT-L2)의 세포 내 루프의 두 번째 절반에 해당하는 세포 투과 펩타이드를 개발 박사 Leybaert의 연구소와 협력했다 Cx43 hemichannels Cx43 갭 접합 채널 활동 33을 유지하면서. 우리의 연구에서 우리는 Cx43 hemichannels의 완전한 억제를 얻기 위해 100 μM TAT-L2를 사용하지만 낮은 농도는 충분히 72 수 있습니다. TAT-L2H126K/I130N은 음성 대조군 73로 추천합니다. Panx1 채널의 기여를 평가하기 10Panx1 펩타이드를 적용 할 수 있습니다. 이러한 도구는 (M 같은 세포막 중단 (아래 참조)을 제외한위한, 또한 hemichannels가 아닌 다른 메커니즘에 의해 해당 paracrine ATP 신호를 중재에게 간 칼슘 2 + 파 전파의 메커니즘을 보여주는위한뿐만 아니라 중요하다AXI-음이온 채널이나 ATP 함유 소포의 자료). 마지막으로, 일차 전지를 사용하는 모든 연구는, 세포 배양 조건 및 통로의 수는 세포의 생물학적 속성으로 표준화해야하며 따라서 다른 CX는 및 Panx의 아형의 발현 프로파일은 시간이 26에 변경 될 수 있습니다. 그럼에도 불구하고,이 방법의 단점은 여러 가지가있을 수 있습니다. 방법의 주요 단점은 기계적 자극이 세포 칼슘의 입구로 이어지는, 세포막 중단을 트리거 할 수 있습니다 +와 선의의 간 칼슘 2 + 파 전파 11 기초 둘 다 ATP와 같은 신호 분자의 방출. 이것은 확실히 간 칼슘 2 + - 파 (정량) 분석을 복잡. 따라서, 그것은 매우 하나) 적절한 컨트롤, CX는 또는 Panx의 아형의 발현이없는 즉 세포주 및 도구를 I을 사용하는 것이 좋습니다 그 적분갭 접합 채널 및 / 또는 hemichannels과 II로 CX는 및 Panx의 기능 rfere ()를 기계적 자극하는 동안 나노 위치가 0.5 ~ 2 V 사이의 전압으로 작동되어 있는지 확인) 기계적 자극 절차를 표준화. 또한,이 방법은 그 자체로 서 있지 않는 것을주의하는 것이 중요하지만, CX는 및 Panx 채널을 공부하기 위해 추가 실험 방법에 의해 뒷받침되어야한다. 이 세포 내 IP 3 칼슘 2 + 11,74의 uncaging 같은 기계적 자극 - 매개 세포 내 칼슘 2 + 파 전파에 참여하는 세포 내 신호 분자의 로컬 증가를 사용하여 수행 할 수 있습니다. 간 칼슘 기계적 자극의 독립적 + 파, 하나 + - 버퍼 세포에서 지방의 저하가 발생 디아-2처럼 같은 재조합 프로 고사 백스 11,75 및 사진 기동 칼슘과 같은 마이크로 주사를 사용할 수 있습니다 시작하려면 [칼슘 2 + </저녁을 먹다&gt;] 76, hemichannel 개방에 대한 알려진 트리거.에게 또는, 하나는 세포 내 칼슘을 유발하는 세포 투과성 신호 분자의 현장 일렉트로에서 사용할 수있는 + 방출하고 세포 간 칼슘과 같은 IP 3 67,68으로 + - 파도.에게 후자의 방법은 세포 죽음 5,77의 확산을 조사하는 데 사용됩니다. 이러한 비 기계적 자극은 자극 강도 반응의 더 나은 평가를 제공합니다. 이러한 칼슘 2 + 파 전파 방법 이외에, 그것은 친수성 염료 흡수의 결정 (루시퍼 노란색 등) 78와 ATP의 방출뿐만 아니라있는 등 다른 방법을 사용하여 CX는 나 Panx 채널의 활동을 결정하는 것이 중요합니다 또한 세포 칼슘 2 + - 버퍼 (EGTA 등) 및 세포 내 칼슘 2 + - 릴리스 물질 (칼슘 2 + - 이온 운반체 A23187 같은) 11,74 님의 질문에 기계적 자극에 반응. 또한, T그는 채널 수준에서 규제 최선의 증거는 전기 생리학 실험, 이중 전압 클램프 시스템을 하나 또는 ectopically GFP와 같은 마커와 함께 CX는 아형을 표현 CX는 나 Panx 발현이나 헬라 세포의 주입 Xenopus의 난자의 전체 세포 경로 클램프에 의해 제공됩니다 79-84. 결론적으로, 세포 간 칼슘을 유도를위한 기계적 자극의 사용은 + - 파도 세포 통신을 조사하고 Cx가와 Panx 채널의 기여와 속성을 검사하는 간단하고 신뢰할 수있는 방법을 제공한다.

간 통신 및 신호는 조직과 전체 - 장기 레벨 1,2에서 세포 촉진제 님의 질문에 생리적 인 과정의 조정을 위해 필수적입니다. 간 의사 소통의 가장 직접적인 방법은 간격 접속점의 발생에 의해 만들어집니다. 갭 접합 3,4 인접 셀의 두 넥신 (CX는) hemichannels (그림 1)의 헤드 투 헤드 도킹에 의해 형성 단백질 성 채널입니다 간격 접합 채널의 패이다. 갭 접합 발생 및 변조 칼슘 이웃 세포 ​​6 (그림 2)의 세포 내 상점에서 + 릴리스., 칼슘 2 + 또는 IP 5 등 이하 1.5 kDa의 분자량은 작은 신호 분자의 통과를 허용 갭 접합 채널은 밀접하게 산화 환원 수정 및 같은 내 및 분자간 단백질 상호 작용에 의해 및 세포 신호 전달 과정에 의해 조절된다인산화 7. GJS 그로 인하여 화학 및 전기 syncytium 역할, 연결된 세포의 조정 반응을 촉진한다. 예를 들어, 심방 및 심실 근육 세포를 통해 심장 활동 전위의 확산은 CX-기반 GJ 채널 85에 의해 중재된다. CXS는 갭 접합 채널로서 역할을 할뿐만 아니라 짝 hemichannels을 형성하여 정기적으로 이온 채널 8-10 (그림 1)과 유사 세포막 채널로 작동하지 않습니다. Hemichannels는 내부와 세포 외 환경 사이 이온 및 신호 분자의 교환을 제어하여 이웃 세포 사이 paracrine 신호에 참여할 수 있습니다. 많은 종류의 세포 (상피 세포, 조골 세포, 성상 세포, 내피 세포 등과 같은) 및 장기 (뇌, 간, 망막, 달팽이관과 혈관 등)에 간 칼슘 2 + - 파도 다세포 반응의 조정을위한 기본적인 <suP&gt; 11. 특정 셀에 내 Ca 2 + 농도의 증가는이 셀로 제한하지만, 그로 인하여 간 칼슘 2 + 파 12,13 구축, 주변 이웃 세포에 전달되지 않습니다. 이러한 세포 간 칼슘 2 + - 파도 syncytium과 조절 장애는 병태 생리 학적 과정 11과 관련되어 같은 셀 계층의 정상적인 생리 조절을 위해 중요하다. 각막 내피 세포와 상피 세포에서, 우리 자신의 25-33 등 다른 그룹 14-24은 간 통신 메커니즘과 역할을 공부했다. 비 흥분 세포, 각막 내피 세포와 같은 세포 간 의사 소통의 두 가지 모드는 28,29, 즉 갭 접합 간 통신 및 paracrine 간 통신을 발생합니다. 갭 접합 간 통신 간격 분기점 7을 통해 신호 분자의 직접 교환을 포함한다. 갭 접합부tional 간 통신, 조직의 항상성을 유지하는 세포 증식을 조절하고, 세포 스트레스 10,34,35에 동기화 응답을 설정하기위한 중요합니다. 병리 번호, 갭 접합 커플 링으로 인해 결함이 CXS로 감소하고, 이에 갭 접합 간 통신이 36에 영향을 미치고있다. 이 다세포 생물의 격차 접합부 간 의사 소통의 중요성과 영향력을 강조한다. 그것이 확산 성 세포 메신저 (그림 2)의 방출을 포함 이후 격차 접합부 간 통신 대조적으로, paracrine 간 통신, 세포 - 세포 동격에 종속되지 않습니다. 신호 분자의 종류는 세포 신호에 의해 세포 공간에 해제됩니다. 분자 다음은 특정 수용체​​ 단백질에 의해 감지 된 대상 셀에 전송됩니다. 이후 수용체 신호 단지 어떤 세포 반응을 유도신호를 비활성화 또는 탈감작의 제거에 의해 종료됩니다. 출시 친 화성 세포 신호 메신저 멤브레인을 통과하고 세포 내 수용체에 작용합니다. 반면, 친수성 ​​메신저는 응답 세포의 세포막을 통과하지 않는다, 그러나 세포 내 환경에 신호를 중계 표면 발현 수용체 단백질에 결합하는 리간드 역할을합니다. 이온 채널 연결, 효소 결합, 및 G 단백질 - 연결 : 세포 표면 수용체 단백질의 세 가지 주요 가정은이 과정에 참여한다. 발표 메신저 분자가 가까이 (paracrine)에서 표적 세포에 동일한 셀 (autocrine)의 수용체에 작용하거나 순환 시스템 (내분비)가 필요 먼 표적 세포에. 각막 내피 세포 28,29 등 많은 종류의 세포에서, ATP는 세포 간 칼슘 2 + - 파도 37-40의 번식을 구동 주요 친수성, paracrine 요인 중 하나입니다. 지속여러 에이전트가 ING 기계적 변형, 저산소증, 염증이나 자극, ATP는 전단 응력, 스트레칭, 또는 삼투는 44,45 붓기에 대한 응답으로 41-44 건강한 세포에서 해제 할 수 있습니다. 다른 ATP 방출 메커니즘은 기공을 갖는 exocytosis를 44과 같은 ATP 결합 카세트 (ABC) 전송기, plasmalemmal 전압에 의존하는 음이온 채널 46, P2X7 수용체의 채널 47,48뿐만 아니라, 같은 전송 메커니즘의 과다 등 가정되었다 넥신의 hemichannels 49-52과 pannexin의 hemichannels 43,49,53. 세포 ATP는 ADP, AMP에 빠르게 가수 분해와 세포 외 환경에 존재하는 ectonucleotidases로 54,55를 아데노신 수 있습니다. extracellularly 발표 ATP와 그 대사 산물 ADP 56 확산을 통해 확산됩니다. 이웃 세포에서 퓨린 수용체 이러한 뉴클레오티드의 연속적인 상호 작용은 P에 연루되어있다간 칼슘 2 + - 파도 28,37,51의 ropagation. 퓨린 수용체의 두 가지 클래스가 존재한다 : 두 퓨린 (ATP, ADP)과 피리 미딘 (UTP, UDP) 뉴클레오티드 가장 P2-purinoceptors 57에 따라 행동하면서 아데노신은 P1-purinoceptors의 주요 천연 리간드이다. 간 통신 등의 부스러기 로딩, 염료 전송, IP 3 칼슘 2 +, 기계적 자극, 등과 같은 작용제 지역의 uncaging 등 다양한 방법으로 조사 할 수 있습니다. 여기에서 우리는 + 웨이브 전파는 단일 세포의 기계적 자극으로 이끌어 칼슘의 연구를 설명합니다. 기계적 자극에 의해 칼슘 2 + 파 전파 연구의 장점은 + 파 시간에 칼슘의 확산을 정량화하기 쉬운 도구를 제공하고 정량적으로 세포의 다른 전처리를 비교 할 수 있다는 것입니다. 각막 내피 세포에서 이러한 세포 간 칼슘 2 + - 파도 공동 수단층에서 조정 된 응답, 이에 안구 수술하는 동안 세포 스트레스를 견딜 수있는 내피를 돕는 비 재생 각막 내피 세포의 가능한 방어 메커니즘으로 작용 또는 면역 거부 또는 포도막염 58,59 동안 염증 매개체에 노출에.

<table border="1">
<tbody>
 <tr>
 <td>Name of Reagent/Material</td>
 <td>Company</td>
 <td>Catalog Number</td>
 <td>Column1</td>
 </tr>
 <tr>
 <td>Earle's Balanced Salt Solution (EBSS)</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>14155-048</td>
 <td></td>
 </tr>
 <tr>
 <td>Iodine</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>38060-1EA</td>
 <td></td>
 </tr>
 <tr>
 <td>Dulbecco's Modified Eagle's Medium (DMEM)</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>11960-044</td>
 <td></td>
 </tr>
 <tr>
 <td>L-glutamine (Glutamax)</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>35050-038</td>
 <td></td>
 </tr>
 <tr>
 <td>Amphotericin-B</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A2942</td>
 <td></td>
 </tr>
 <tr>
 <td>Antibiotic-antimycotic mixture</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>15240-096</td>
 <td></td>
 </tr>
 <tr>
 <td>Trypsin</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>25300-054</td>
 <td></td>
 </tr>
 <tr>
 <td>Dulbecco's PBS</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>14190-091</td>
 <td></td>
 </tr>
 <tr>
 <td>Fluo-4 AM</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>F14217</td>
 <td></td>
 </tr>
 <tr>
 <td>ARL-67156 (6-N,N-Diethyl-b,g-dibromomethylene-D-ATP) </td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A265</td>
 <td></td>
 </tr>
 <tr>
 <td>Apyrase VI</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A6410</td>
 <td></td>
 </tr>
 <tr>
 <td>Apyrase VII</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A6535</td>
 <td></td>
 </tr>
 <tr>
 <td>Gap26 (VCYDKSFPISHVR)</td>
 <td>Custom peptide synthesis</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>Gap27 (SRPTEKTIFII)</td>
 <td>Custom peptide synthesis</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>Control Peptide (SRGGEKNVFIV)</td>
 <td>Custom peptide synthesis</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>siRNA1 Cx43 (sense: 5'GAAGGAGGAGGAACU-CAAAdTdT) </td>
 <td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>siRNA2 Cx43 (sense: 5'CAAUUCUUCCUGCCGCAAUdTdT) </td>
 <td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>siRNA scramble: scrambled sequence of siCx43-1 (sense: 5'GGUAAACG-GAACGAGAAGAdTdT) </td>
 <td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>TAT-L2 (TAT- DGANVDMHLKQIEIKKFKYGIEEHGK)</td>
 <td>Thermo Electron (Ulm, Germany)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>TAT-L2-H126K/I130N (TAT-DGANVDMKLKQNEIKKFKYGIEEHGK) </td>
 <td>Thermo Electron (Ulm, Germany)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td></td>
 <td></td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>Two chambered glass slides</td>
 <td>Laboratory-Tek Nunc (Roskilde, Denmark)</td>
 <td>155380</td>
 <td></td>
 </tr>
 <tr>
 <td>Confocal microscope </td>
 <td>Carl Zeiss Meditec (Jena, Germany)</td>
 <td>LSM510</td>
 <td></td>
 </tr>
 <tr>
 <td>Piezoelectric crystal nanopositioner (Piezo Flexure NanoPositioner)</td>
 <td>PI Polytech (Karlsruhe, Germany)</td>
 <td>P-280</td>
 <td></td>
 </tr>
 <tr>
 <td>HVPZT-amplifier</td>
 <td>PI Polytech (Karlsruhe, Germany)</td>
 <td>E463 HVPZT-amplifier</td>
 <td></td>
 </tr>
 <tr>
 <td>Glass tubes (glass replacement 3.5 nanoliter)</td>
 <td>World Precision Instruments, Inc. Sarasota, Florida, USA</td>
 <td>4878</td>
 <td></td>
 </tr>
 <tr>
 <td>Microelectrode puller </td>
 <td>Zeitz Instrumente (Munchen, Germany)</td>
 <td>WZ DMZ-Universal Puller</td>
 <td></td>
 </tr>
</tbody>
 </table>

mechanical stimulation-induced calcium wave propagation in cell monolayers: the example of bovine corneal endothelial cells

간 통신은 뇌, 간, 망막, 달팽이관 및 혈관 등의 장기와 조직의 다양한 세포 사이의 생리적 인 과정의 조정을 위해 필수적이다. 실험 설정에서, 세포 간 칼슘 2 + - 파도 하나의 세포에 기계적 자극을 적용하여 이끌어 할 수 있습니다. 이 세포 내 신호 IP 분자 3 칼슘의 출시에 이르게 + 이웃 세포에 기계적 자극 셀에서 + 파 동심 칼슘의 번식을 시작합니다. 간 칼슘 2 + 파 전파를 제어하는 주요 분자 경로는 IP 3의 직접 전송을 통해와 ATP의 방출을 통해 hemichannels으로 갭 접합 채널에 의해 제공됩니다. 속성과 다른 넥신 갭 접합 채널 hemichannels로 pannexin 이소 규제의 식별 및 특성화 quantificatio에서 허용하는N 간 칼슘 2 + 파, siRNA를, 그리고 갭 접합 채널 hemichannels 억제제의 사용의 확산. 여기, 우리는 그 결과로 간 칼슘이 세포의 급성, 짧은 지속 변형에 의해 자극 통제 및 지역화 기계적 자극에 대한 응답으로 Fluo4 암으로로드 차 각막 내피 세포의 단일 층에있는 + 파를 측정하는 방법을 설명 이하 1 ㎛의 팁 직경 micromanipulator에 제어 유리 micropipette를 가진 세포막을 감동. 우리는 또한 주 소 각막 내피 세포와 + - 파도 ATP의 방출을 통한 세포 간 칼슘의 중심 세력으로 Cx43-hemichannel 활동을 평가하기위한 모델 시스템으로 사용의 분리를 설명합니다. 마지막으로, 우리는 사용, 장점, 한계와 갭 접합 채널 hemichannel 연구의 맥락에서이 방법의 대안을 논의한다.

모든 실험은 모든 관련 지침, 규정 및 규제 기관 준수에 실행되고 설명되는 프로토콜은 KU 루벤의 동물 관리 및 사용위원회의지도 및 승인하에 수행됩니다. 소 각막 내피 세포 (BCEC)에서 기능성 간격 접속점은 표현 격차 접합부 간 통신 및 paracrine 간 통신을 모두 상호 작용하는 방식 간 통신에 크게 기여하지만 주요 통로에 의해 중재 paracrine 간 통신 경로로 표시되었습니다 있습니다 Cx43 기반 hemichannels 28,29을 통해 ATP 자료. ATP와 ADP는 ectonucleotidase E-NTPD1 (ectonucleoside 인산 diphosphohydrolase 1, CD39 ATP diphosphohydrolase)에 의해 인산염 (AMP)을 아데노신을 가수 분해하고, 이후 5&#39;-ectonucleotidase CD73 28,29으로 아데노신 할 수 있습니다. ATP와 ADP는에 기여P2Y1와 P2Y2 수용체 28,29에 결합하여 칼슘 2 + 파 전파. 수용체되어 Gq를 통해 PLC에 몇함으로써 IP 보여주고 모두 3에 의한 칼슘 2 + 릴리스 (그림 2). BCEC에서의 급속한 증가 퓨린 P2Y 수용체 결과의 자극 [칼슘 2 +] [칼슘 2 +] O 60의 제거에 민감하다 나. [칼슘 2 +] 작용제의 자극에 의해 유발 나는 피크가 안정 작용제에 의존 상승으로 이어질 수있는 [칼슘 2 +] 나는 감소가옵니다 [칼슘 2 +] O에 의존 진동 변동, 또는 기준선에 반환 60-62. BCEC, 캘리포니아 2 + 방출 PLC 및 IP 3 29를 포함하는 경로를 통해 발생하는 증거가있다. IP 3에 맞는 점포 비우면에 초기 피크에 이르게 캘리포니아에 [칼슘 2 +] i를 연속적으로 다음pacitative 칼슘 2 + 유입 고원 단계 63의 발병으로 이어지는. 기계적 자극이 칼슘의 급격한 초기 상승에 이르게 + 자극의 시점에서 유래 한 후 기계적 자극을 세포 전체에 확산합니다. 마지막으로, 세포 내 칼슘 2 + - 레벨 서서히 기본 수준으로 다시 감소. 셀 경계에 도달하면, 기저 수준 (그림 3)에 붕괴 칼슘 2 + 과도 같은 파도 같은 방식으로 주변의 이웃 세포 ​​(NB)에 간 칼슘 2 + 파 전파합니다. 제어 조건에서, 칼슘 2 + 과도 멀리 기계적 자극 세포 (그림 3)에서 약 4-8 세포층까지 관찰되었다. 선 그래프 (그림 3의 패널의 오른쪽에있는) 칼슘 2 시간 과정을 보여줍니다 + 과도 (정규화 된 형광 (NF) 값으로 표현)의기계적 자극 셀과 이웃 셀 레이어 1-5 (NB1, NB2, NB3, NB4 및 NB5). 그림 3에서, 그것은 분명 그 표준화 된 형광 감소, 동안의 발병에 대한 시간 지연 [칼슘 2 +] 기계적 자극 세포에서 증가 거리를 나 상승 증가합니다. 기계적 자극 셀의 최대 정규화 된 형광은 0.95에 도달 ± 0.04 초. 최대 정규화 된 형광 값에 도달 한 후, 정규화 된 형광 기저 값 152을 반환 ± 6 초 자극 (25)의 신청 후, 매우 점진적이고 느린 감소를 보였다. 외인성 apyrase VI (30 분 10 U / ㎖) 및 apyrase VII (30 분 10 U / ML)의 조합을 사용하여 paracrine 간 통신 경로의 억제는 칼슘에 의해 보호 지역의 7.5 배 감소 원인 + 웨이브, 소위 활성 영역 (AA, P &lt;0.001, N = 7, N = 35) (그림 4A). Apyrase는 ATP와 ADP를 가수 분해하는 것으로 알려져 있습니다. Apyrase VI는 높은 ATPase의 / ADPase 비율 apyrase VII 우선적으로 가수 분해 ADP 56있다. 각막 내피 세포의 paracrine 간 통신은 주로 ATP 방출, 28,29를 통해 발생 ATP가 각막 내피 세포에서 발현되는 것으로 알려져 ectonucleotidases, 29,64,65에 의한 세포 공간에서 가수 분해 때문에 우리는 조건에서 AA에 미치는 영향을 조사 위치는 ATP 가수 분해는 ectonucleotidase 억제제를 사용하여 억제합니다. ARL-67156 (ARL, 30 분 100 μM)와 ectonucleotidases의 억제 BCEC 25,26,28,29 이전에 설명 된대로, + 파 전파 칼슘 강한 강화 결과. (그림 4B) ARL하는 BCEC의 노출 조건 (N = 12, N = 60 P &lt;0.001)를 제어에 비해 AA의 3.5 배 증가를 일으켰습니다. 사전에우리의 실험실, 넥신 모방 펩타이드 (Gap26 및 Gap27, 표 2)에서 vious 연구는 비활성 펩타이드 (기계적인 자극에 따라 세포 내 칼슘 2 + 파 전파에 격차 접합부 간 통신 및 paracrine 간 의사 소통의 상대적 기여도를 구분하는 데 사용되었다 컨트롤 28,29 표 2). Gap27와 갭 접합 채널의 억제가 크게 + 웨이브 BCEC 30에서 칼슘의 전파를 감소. AA이 크게 Gap27 (30 분 300 μM)로 전처리에 따라 감소 하였다 (P &lt;0.001, N = 8, N = 40) 25 (표 1). 넥신 모방 펩타이드 Gap26 28, 30과 넥신 hemichannels의 억제가 크게 + 웨이브 BCEC 28 칼슘의 전파를 감소시켰다. AA이 크게 Gap26 (30 분 300 μM)로 전처리에 따라 감소되었다(P &lt;0.001, N = 8, N = 40) 25 (표 1). 우리는 또한 43-kDa의 CX는 이소 간 칼슘 2 + - 파도를 유발 hemichannel 매개 ATP 자료를 기본 주요 구성 요소 이었다는 것을 보여 주었다. Cx43을 대상으로 두 개의 독립적 설계의 siRNA 분자를 사용하여, 우리는 AA가 65 % 33 (표 1)에 의해 감소 된 것으로 나타났습니다. 이것은 더 TAT-L2 (100 μM, 30 분), AA의 주요 감소 (P &lt;0.001을 자극 Cx43의 세포 내 루프의 두 번째 절반 (표 2)에 해당하는 세포 투과 펩타이드를 사용하여 실험을 뒷받침했다 , N = 3, N = 30) (표 1). 중요한 것은, TAT-L2 배양하여 AA이 감소 TAT-L2 선택적으로 Cx43 기반 hemichannels하지만 간격 접합 채널 33을 억제하는 개념을 지원 paracrine 신호의 부재에서 관찰되지 않았다. 또한, 비활성 TAT-L2 돌연변이 (TAT-L2 H126K/I130N)는 제어 (표 2)로 사용할 수 있습니다. <img alt="그림 1" fo:content-width="6in" fo:src="/files/ftp_upload/50443/50443fig1highres.jpg" src="/files/ftp_upload/50443/50443fig1.jpg" /> 그림 1. 도식 표현 : 갭 접합 채널 hemichannels의 형성. 네 횡단 도메인을 포함하는 단백질 여섯 connexins 또는 pannexins가 방사상으로 중앙 구멍 주위에 배치 될 때 A. 넥신 또는 pannexin hemichannel이 형성된다. Hemichannels는 원형질막에 있습니다. 그들은 동일한 단백질 아형 (homomeric hemichannels)으로 구성 할 수 있습니다하거나 두 개 이상의 아형이 동일한 셀 (heteromeric hemichannels)로 표현하는 다른 단백질 하위 유형으로 구성 될 수 있습니다. homotypic 갭 접합 채널은 두 개의 동일한 homomeric 또는 heteromeric hemichannels의 도킹 결과. D의 이형 간격 접합 채널 결과두 개의 서로 다른 homomeric 또는 heteromeric 채널의 ocking. 넥신 두 개의 인접한 세포 hemichannels를 연결 pannexin 간격 접합 채널 B. 도식 구조. (부분적으로 66에서 수정) 이 그림은 원래 BioEssays 년에 출판되었다. Catheleyne D&#39; hondt, 공군 Ponsaerts는 Smedt, Geert Bultynck, 버나드 Himpens 드 베르트. Pannexins 특정 세포 기능과 넥신 가족의 먼 친척. BioEssays. 2009 년 31 953-974 (2009). BioEssays가. <a href="https://www-jove-com.remotexs.ntu.edu.sg/files/ftp_upload/50443/50443fig1large.jpg" target="_blank">큰 그림을 보려면 여기를 클릭하십시오</a> . <img alt="그림 2" fo:content-width="6in" fo:src="/files/ftp_upload/50443/50443fig2highres.jpg" src="/files/ftp_upload/50443/50443fig2.jpg" /> 그림 2. 비 흥분 세포에서의tercellular 칼슘 2 + 파 전파 간격 접합 간 통신 및 paracrine 간 통신을 모두 포함한다. 단일 셀, + - 상승 칼슘 통해 기계적 자극 세포 (MS)에서 발생하는 칼슘의 기계적 자극시 + - 유입 및 / 또는 칼슘 2 + 릴리스. 그 후,에서 칼슘 2 + - 상승 전파가 기계적으로 간 칼슘 2 + 파 등 주변 세포 (NB)에 자극. 간 전파는 두 가지 메커니즘, 즉 갭 접합 간 통신 및 paracrine 간 통신을 포함한다. 갭 접합 간 통신, 중재자의 직접적인 교환 (IP 3 및 / 또는 칼슘 2 +)는 갭 접합 (GJS)를 통해 인접 세포의 세포질 사이에 발생합니다. paracrine 간 통신, 메신저 (예 : ATP)을함으로써 일에있는 수용체에 작용, 세포 공간에 출시이웃 세포의 전자 표면. Hemichannels (탄화수소) 또는 다른 메커니즘 (텍스트 참조)이 ATP 방출을 중재. ADP와 AMP에 Ectonucleotidases 가수 분해 ATP. ATP와 P2Y 및 / 또는 인접 세포 P2X 수용체 ADP 역할을합니다. (66에서 찍은.) 이 그림은 원래 BioEssays 년에 출판되었다. Catheleyne D&#39; hondt, 공군 Ponsaerts는 Smedt, Geert Bultynck, 버나드 Himpens 드 베르트. 특정 세포 기능을 가진 넥신 가족의 Pannexins, 먼 친척. BioEssays. 2,009. 31, 953-974 (2009). BioEssays. <img alt="그림 3" src="/files/ftp_upload/50443/50443fig3.jpg" /> 그림 3. BCEC의 제어 조건에서 칼슘 파의 전파. 기계 자극을 유도 칼슘 과도은 대표적인 의사 색 형광 이미지로 BCEC의 제어 조건에서 시간 점 다른에 표시됩니다. fluore자극 전에 scence를 강도는 첫 번째 이미지에 표시됩니다. 두 번째 이미지에 흰색 화살표는 기계적 자극 셀을 식별합니다. 62,870 μm의 2 : 칼슘 파 파 (AA 활성 영역)에 도달 세포의 총 면적은 6 개의 이웃 세포 ​​층에 전파됩니다. 선 그래프 오른쪽 패널에 기계적 자극 셀의 정규화 된 형광 값 (NF) (MS)와 이웃 세포에서 NF의 평균 값 (NB) 레이어 1 ~ 5 (NB1에 NB5)의 시간 과정을 보여줍니다. (부분적으로 25 일부터 수정했습니다.) 이 그림은 원래 조사 안과 및 Visual 과학에 출판되었다. Catheleyne D&#39; hondt, 공군 Ponsaerts, Sangly P 스 리니, 요한 Vereecke, 버나드 Himpens. 트롬빈은 hemichannels 갭 접합의 변조에 의해 각막 내피 세포 간 칼슘 파의 전파를 억제. 투자. 안과. 비스. 과학. 2,007. <stroNG&gt; 48 (1), 120-33 (2007 년). 조사 안과 및 Visual 과학. <img alt="그림 4" fo:content-width="5.5in" fo:src="/files/ftp_upload/50443/50443fig4highres.jpg" src="/files/ftp_upload/50443/50443fig4.jpg" /> 그림 4. + - 파도 외생 nucleotidases (왼쪽)와 치료 후와 BCEC의 ectonucleotidase 억제제 (오른쪽)와 함께 간 칼슘의 보급에 상당한 변화. ATP와 ADP 가수 분해 외생 apyrases (apyrase VI (5 U / ㎖) 및 apyrase VII (5 U / ㎖) 30 분), 이에 억제 paracrine 간 통신 경로 (와 BCEC의 치료 후 AA의 A. 크게 감소 N = 7, N = 35). * P에게 apyrase의 존재 대 부재 &lt;0.001을 의미 선택적 ectonucleotidase 억제 ARL-67156 (ARL, 30 분 100 μM)와 BCEC의 치료 후 AA에서 B. 크게 증가., 본성 enhancin는G paracrine 간 통신 경로 (N = 12, N = 60). * ARL의 존재 대없는 상태에서 P &lt;0.001을 의미합니다. <table border="1"><tbody><tr><td></td><td> 정규화 AA </td><td> 세인트 오류 </td><td> N </td><td> N </td><td> 통계 </td></tr><tr><td> 제어 </td><td> 100 </td><td> 8.31 </td><td> 3 </td><td> 30 </td><td></td></tr><tr><td> siScramble </td><td> 87.97 </td><td> 9.3 </td><td> 3 </td><td> 30 </td><td></td></tr><tr><td> siCx43-1 </td><td> 32.45 </td><td> 8.23 </td><td> 3 </td><td> 30 </td><td> * </td></tr><tr><td> siCx43-2 </td><td> 35.49 </td><td> 7.06 </td><td> 3 </td><td> 30 </td><td> * </td></tr><tr><td> 제어 펩타이드 </td><td> 91.68 </td><td> 6.5 </td><td> 8 </td><td> 40 </td><td></td></tr><tr><td> 갭 26 </td><td> 46.​​67 </td><td> 4.24 </td><td> 8 </td><td> 40 </td><td> * </td></tr><tr><td> 갭 27 </td><td> 53 </td><td> 4.76 </td><td> 8 </td><td> 40 </td><td> * </td></tr><tr><td> TAT-L2 </td><td> 6.99 </td><td> 0.71 </td><td> 3 </td><td> 30 </td><td> * </td></tr></tbody></table> 표 1. (AA) BCEC의 정규화 된 활성 영역에 Cx43, 넥신 모방 펩타이드 세포 투과 펩타이드 TAT-L2를 대상으로 siRNA를 분자의 효과. N은 실험 일 수를 나타내고, N은 기계적 자극의 수를 나타냅니다. * 의미 P 제어 조건에 비해 &lt;0.001. <table border="1"><tbody><tr><td></td><td> AA 순서 </td></tr><tr><td> 제어 펩타이드 </td><td> SRGGEKNVFIV </td></tr> &lt;TR&gt; <td> Gap26 </td><td> VCYDKSFPISHVR </td></tr><tr><td> Gap27 </td><td> SRPTEKTIFII </td></tr><tr><td> TAT-L2 </td><td> YGRKKRRQRRR-DGANVDMHLKQIEIKKFKYGIEEHGK </td></tr><tr><td> TAT-L2H126K/I130N </td><td> YGRKKRRQRRR-DGANVDMKLKQNEIKKFKYGIEEHGK </td></tr><tr><td> 10Panx1 </td><td> WRQAAFVDSY </td></tr></tbody></table> 표 2. 사용 된 펩티드의 아미노산 서열.

Watch this Scientific Journal Video about Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells at JoVE.com

Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells

간 카<sup&gt; 2 +</sup&gt; - 파도 갭 접합 채널 hemichannels에 의해 구동됩니다. 여기, 우리는 세포 간 칼슘을 측정하는 방법을 설명<sup&gt; 2 +</sup&gt; - 파 지역의 단일 셀 기계적 자극과 속성과 간격 접합 채널 hemichannels의 규정을 조사하기 위해 해당 응용 프로그램의 질문에 답변 세포 단층합니다.

세포 단일 층의 기계적 자극에 의​​한 칼슘 웨이브 전파 : 소 각막 내피 세포의 예

Intercellular communication is essential for the coordination of physiological processes between cells in a variety of organs and tissues, including the ...

mechanical-stimulation-induced-calcium-wave-propagation-cell

Nanyang Technological University

Research

JoVE Journal

Biology

16.2K 조회수.  KU Leuven. 간 카 2 + - 파도 갭 접합 채널 hemichannels에 의해 구동됩니다. 여기, 우리는 세포 간 칼슘을 측정하는 방법을 설명 2 + - 파 지역의 단일 셀 기계적 자극과 속성과 간격 접합 채널 hemichannels의 규정을 조사하기 위해 해당 응용 프로그램의 질문에 답변 세포 단층합니다.

비디오: Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells

Propagation of Human Embryonic Stem (ES) Cells

Propagation of Human Embryonic Stem ES Cells

Yeah, so I'm Lauren Deon. I'm in charge of the Human Amgen stem cell co facility at MGH. Yeah, so I'm Lauren, I'm in charge of the Human AM stem cell co facility at MGH.So I've been working with human Amgen stem cells for years now since I was a postdoc in George De Lab before, from four, four years. And so right now we have two cell lines, H one and H nine, which are both from Y cell. And so the way we are expanding or maintaining these cells in culture is by, at least the way we are splitting these cells is by using collagenous.So what I usually do is for the first few passage after throwing the cells, I use a technical, the picking colonies. So in this case, I can check under the microscope which colonies are good and differentiate and nice shape, and I will collect only these colonies and I will cut them in few pieces and put them back in, in a fresh flat. And the, the colonies that look kind of differentiate it are just left them alone.The other way to pass the cells is by using trypsin. So I don't use this technique here. I think collagenase is a little bit safer because human being stem cells don't like to be individualized or they don't like to be alone.So if you do trypsin, if you use trypsin for a little bit too long, if you use it for like three to four minutes, which is the way we use strips in for other type of cells, human stem cells will be individualized and most of them will die or just differentiate or will not attach to the myth. So the idea is you have to keep the cells as clumps. You don't want them to be alone in the in, in the flask.So using collagenase, the advantage is to keep cells as plants. Using chipsy, you just select for cells that will survive this very, very harsh process of g opsonization. So these cells are usually very highly proliferative.So you get, you can adapt your cells to this tripsin process. The problem is that you have cells that they behave differently, they go much faster. And one risk is that you can get some commercial abnormality to, to this, to this very high division process.So you say that ization can cause selection of cells in culture for most proliferative cells.Right. More ative and probably also higher survival rates than other cells. So after proliferation, basically culture after proliferation in tripsin, after several passages become a different culture, these different properties.So it's, it's hard to figure out if they are exactly identical. If you do the test, the usual test, let's say you check markers, regular markers of end differentiated cells like OC four, nano one 60 SC four C, C3, all this molecule might still be expressed. If you do TER formation, this cells might still differentiate and be formed like al like normal cells.If you look at the karyotype, you might have some abnormality, but you might still have a normal karyotype. The, the, the selective advantage might be due to just a mutation that you cannot see by doing a karyotype. So the fact that they grow much faster is by itself I think a little bit worser.And if we want to use these cells for transplantation at some point, I would definitely not use this type of cells.Okay. So would you like to tell me what are the main technical problems with using this technique for, for passages of cells? So using S, yes.It's just a little bit longer and also it's, since the cells are not going as fast, it's just much longer to get a high number of cells to do some experiment. So it's just less convenient I would say. Would you like to tell me about few words about the goals of your experiment?How do you use CS cells? Okay, so my main project here is to get endothelial cells from human AB stem cells. And the idea is to be able to make blood.And we are working a lot with tissue bioengineering labs and one of their goal is to make tissue in vitro. But one of the limitation to this is the lack of blood vessels going through this tissues. So if we can bring endothelial cells or put endothelial cells in this tissue, we would have better growth of this tissue.So the idea few sources of cells are known for endothelial cells like cold blood or pressure blood, but it would be interesting to have another source of cells like human years. And the advantage is since human years can be expanded and most infinitely, you could modify these cells, make some inducible system and be able to use it. Then in your final product, your material cells, in this case.

인간의 배아 줄기 (ES) 세포의 전파

연구

생물학

Isolation and Large Scale Expansion of Adult Human Endothelial Colony Forming Progenitor Cells

This paper introduces a novel recovery strategy for endothelial colony forming progenitor cells (ECFCs) from heparinized but otherwise unmanipulated adult human peripheral blood within a mean of 12 days. After large scale expansion &gt;1x108 ECFCs can be obtained for further tests. Advantageously by using pHPL the contact of human cells with bovine serum antigens can be excluded. By flow cytometry and immunohistochemistry the isolated cells can be characterized as ECFC and their in vitro functionality to form vascular like structures can be tested in a matrigel assay. Further these cells can be subcutaneously injected in a mouse model to form functional, perfused vessels in vivo. After long term expansion and cryopreservation proliferation, function and genomic stability appear to be preserved. 3,4
This animal-protein free isolation and expansion method is easily applicable to generate a large quantity of ECFCs.

Endothelial colony forming progenitor cells (ECFCs) are a promising tool to study vascular homeostasis and repair.1,2 This paper introduces a novel animal-serum free method for isolation and expansion of ECFC from heparinised adult human peripheral blood with pooled human platelet lysate (pHPL) diminishing the risk of anti-bovine immunisation.

분리 및 성인 인간 내피 콜로니 형성 전구 세포의 대규모 확장

This paper introduces a novel recovery strategy for endothelial colony forming progenitor cells (ECFCs) from heparinized but otherwise unmanipulated adult ...

Isolation of Valvular Endothelial Cells

Heart valves are solely responsible for maintaining unidirectional blood flow through the cardiovascular system. These thin, fibrous tissues are subjected to significant mechanical stresses as they open and close several billion times over a lifespan. The incredible endurance of these tissues is due to the resident valvular endothelial (VEC) and interstitial cells (VIC) that constantly repair and remodel in response to local mechanical and biological signals. Only recently have we begun to understand the unique behaviors of these cells, for which in vitro experimentation has played a key role. Particularly challenging is the isolation and culture of VEC. Special care must be used from the moment the tissue is removed from the host through final plating. Here we present protocols for direct isolation, side specific isolation, culture, and verification of pure populations of VEC. We use enzymatic digestion followed by a gentle swab scraping technique to dislodge only surface cells. These cells are then collected into a tube and centrifuged into a pellet. The pellet is then resuspended and plated into culture flasks pre-coated with collagen I matrix. VEC phenotype is confirmed by contact inhibited growth and the expression of endothelial specific markers such as PECAM1 (CD31), Von Willebrand Factor (vWF), and negative expression of alpha-smooth muscle actin (&alpha;-SMA). The functional characteristics of VEC are associated with high levels of acetylated LDL. Unlike vascular endothelial cells, VEC have the unique capacity to transform into mesenchyme, which normally occurs during embryonic valve formation1. This can also occur during significantly prolonged post confluent in vitro culture, so care should be made to passage at or near confluence. After VEC isolation, pure populations of VIC can then be easily acquired.

We provide a method for isolating and culturing pure populations of heart valve endothelial cells (VEC). VEC can be isolated from either side of the cusp or leaflet and immediately following, underlying interstitial cell (VIC) isolation is straightforward.

판막병 내피 세포의 분리

Heart valves are solely responsible for maintaining unidirectional blood flow through the cardiovascular system.  These thin, fibrous tissues are ...

Assessment of Calcium Sparks in Intact Skeletal Muscle Fibers

Maintaining homeostatic Ca2+ signaling is a fundamental physiological process in living cells. Ca2+ sparks are the elementary units of Ca2+ signaling in the striated muscle fibers that appear as highly localized Ca2+ release events mediated by ryanodine receptor (RyR) Ca2+ release channels on the sarcoplasmic reticulum (SR) membrane. Proper assessment of muscle Ca2+ sparks could provide information on the intracellular Ca2+&#160;handling properties of healthy and diseased striated muscles. Although Ca2+ sparks events are commonly seen in resting cardiomyocytes, they are rarely observed in resting skeletal muscle fibers; thus there is a need for methods to generate and analyze sparks in skeletal muscle fibers.
Detailed here is an experimental protocol for measuring Ca2+ sparks in isolated flexor digitorm brevis (FDB) muscle fibers using fluorescent Ca2+ indictors and laser scanning confocal microscopy. In this approach, isolated FDB fibers are exposed to transient hypoosmotic stress followed by a return to isotonic physiological solution. Under these conditions, a robust Ca2+ sparks response is detected adjacent to the sarcolemmal membrane in young healthy FDB muscle fibers. Altered Ca2+ sparks response is detected in dystrophic or aged skeletal muscle fibers. This approach has recently demonstrated that membrane-delimited signaling involving cross-talk between inositol (1,4,5)-triphosphate receptor (IP3R) and RyR contributes to Ca2+ spark activation in skeletal muscle. In summary, our studies using osmotic stress induced Ca2+ sparks showed that this intracellular response reflects a muscle signaling mechanism in physiology and aging/disease states, including mouse models of muscle dystrophy (mdx mice) or amyotrophic lateral sclerosis (ALS model).

Described here is a method to directly measure calcium sparks, the elementary units of Ca2+ release from sarcoplasmic reticulum&#160;in intact skeletal muscle fibers. This method utilizes osmotic-stress-mediated triggering of Ca2+ release from ryanodine receptor in isolated muscle fibers. The dynamics and homeostatic capacity of intracellular Ca2+ signaling can be employed to assess muscle function in health and disease.

칼슘의 평가는 그대로 골격 근육 섬유에서 불꽃

Maintaining homeostatic Ca2+ signaling is a fundamental physiological process in living cells. Ca2+ sparks are the elementary units of Ca2+ signaling in ...

Endothelial Cell Tube Formation Assay for the In Vitro Study of Angiogenesis

Angiogenesis is a vital process for normal tissue development and wound healing, but is also associated with a variety of pathological conditions. Using this protocol, angiogenesis may be measured in vitro in a fast, quantifiable manner. Primary or immortalized endothelial cells are mixed with conditioned media and plated on basement membrane matrix. The endothelial cells form capillary like structures in response to angiogenic signals found in conditioned media. The tube formation occurs quickly with endothelial cells beginning to align themselves within 1&#160;hr and lumen-containing tubules beginning to appear within 2 hr. Tubes can be visualized using a phase contrast inverted microscope, or the cells can be treated with calcein AM prior to the assay and tubes visualized through fluorescence or confocal microscopy. The number of branch sites/nodes, loops/meshes, or number or length of tubes formed can be easily quantified as a measure of in vitro angiogenesis. In summary, this assay can be used to identify genes and pathways that are involved in the promotion or inhibition of angiogenesis in a rapid, reproducible, and quantitative manner.

Endothelial Cell Tube Formation Assay for the In Vitro Study of Angiogenesis

The tube formation assay is a fast, quantifiable method for measuring in vitro angiogenesis. Endothelial cells are combined with conditioned media and plated on basement membrane extract. Tube formation occurs within hours and newly formed tubules easily quantified.

에 대한 내피 세포의 관 형성의 분석<em&gt; 체외</em&gt; 혈관 신생 연구

Angiogenesis is a vital process for normal tissue development and wound healing, but is also associated with a variety of pathological conditions. Using ...

Analysis of Oxidative Stress in Zebrafish Embryos

High levels of reactive oxygen species (ROS) may cause a change of cellular redox state towards oxidative stress condition. This situation causes oxidation of molecules (lipid, DNA, protein) and leads to cell death. Oxidative stress also impacts the progression of several pathological conditions such as diabetes, retinopathies, neurodegeneration, and cancer. Thus, it is important to define tools to investigate oxidative stress conditions not only at the level of single cells but also in the context of whole organisms. Here, we consider the zebrafish embryo as a useful in vivo system to perform such studies and present a protocol to measure in vivo oxidative stress. Taking advantage of fluorescent ROS probes and zebrafish transgenic fluorescent lines, we develop two different methods to measure oxidative stress in vivo: i) a &#8220;whole embryo ROS-detection method&#8221; for qualitative measurement of oxidative stress and ii) a &#8220;single-cell&#160;ROS detection method&#8221; for quantitative measurements of oxidative stress. Herein, we demonstrate the efficacy of these procedures by increasing oxidative stress in tissues by oxidant agents and physiological or genetic methods. This protocol is amenable for forward genetic screens and it will help address cause-effect relationships of ROS in animal models of oxidative stress-related pathologies such as neurological disorders and cancer.

Here we report a protocol to measure oxidative stress in living zebrafish embryos. This procedure allows reactive oxygen species (ROS) detection in both whole embryo tissues and single-cell populations. This protocol will accomplish both qualitative and quantitative analyses.

제브라 피쉬 배아에서 산화 스트레스의 분석

High levels of reactive oxygen species (ROS) may cause a change of cellular redox state towards oxidative stress condition. This situation causes ...

Measuring the Osmotic Water Permeability Coefficient (Pf) of Spherical Cells: Isolated Plant Protoplasts as an Example

Studying AQP regulation mechanisms is crucial for the understanding of water relations at both the cellular and the whole plant levels. Presented here is a simple and very efficient method for the determination of the osmotic water permeability coefficient (Pf) in plant protoplasts, applicable in principle also to other spherical cells such as frog oocytes. The first step of the assay is the isolation of protoplasts from the plant tissue of interest by enzymatic digestion into a chamber with an appropriate isotonic solution. The second step consists of an osmotic challenge assay: protoplasts immobilized on the bottom of the chamber are submitted to a constant perfusion starting with an isotonic solution and followed by a hypotonic solution. The cell swelling is video recorded. In the third step, the images are processed offline to yield volume changes, and the time course of the volume changes is correlated with the time course of the change in osmolarity of the chamber perfusion medium, using a curve fitting procedure written in Matlab (the &#8216;PfFit&#8217;), to yield Pf.

Measuring the Osmotic Water Permeability Coefficient Pf of Spherical Cells: Isolated Plant Protoplasts as an Example

Measuring the osmotic water permeability coefficient (Pf) of cells can help understand the regulatory mechanisms of aquaporins (AQPs). Pf determination in spherical plant cell protoplasts presented here involves protoplasts isolation and numerical analysis of their initial rate of volume change as a result of an osmotic challenge during constant bath perfusion.

삼투 물 투수 계수 (P 측정<sub&gt; F</sub&gt;) 구형 세포 : 예를 들어 식물 절연 원형질체

Studying AQP regulation mechanisms is crucial for the understanding of water relations at both the cellular and the whole plant levels. Presented here is ...

Isolation of Murine Valve Endothelial Cells

Normal valve structures consist of stratified layers of specialized extracellular matrix (ECM) interspersed with valve interstitial cells (VICs) and surrounded by a monolayer of valve endothelial cells (VECs). VECs play essential roles in establishing the valve structures during embryonic development, and are important for maintaining life-long valve integrity and function. In contrast to a continuous endothelium over the surface of healthy valve leaflets, VEC disruption is commonly observed in malfunctioning valves and is associated with pathological processes that promote valve disease and dysfunction. Despite the clinical relevance, focused studies determining the contribution of VECs to development and disease processes are limited. The isolation of VECs from animal models would allow for cell-specific experimentation. VECs have been isolated from large animal adult models but due to their small population size, fragileness, and lack of specific markers, no reports of VEC isolations in embryos or adult small animal models have been reported. Here we describe a novel method that allows for the direct isolation of VECs from mice at embryonic and adult stages. Utilizing the Tie2-GFP reporter model that labels all endothelial cells with Green Fluorescent Protein (GFP), we have been successful in isolating GFP-positive (and negative) cells from the semilunar and atrioventricular valve regions using fluorescence activated cell sorting (FACS). Isolated GFP-positive VECs are enriched for endothelial markers, including CD31 and von Willebrand Factor (vWF), and retain endothelial cell expression when cultured; while, GFP-negative cells exhibit molecular profiles and cell shapes consistent with VIC phenotypes. The ability to isolate embryonic and adult murine VECs allows for previously unattainable molecular and functional studies to be carried out on a specific valve cell population, which will greatly improve our understanding of valve development and disease mechanisms.

The ability to isolate heart valve endothelial cells (VECs) is critical for understanding mechanisms of valve development, maintenance, and disease. Here we describe the isolation of VECs from embryonic and adult Tie2-GFP mice using FACS that will allow for studies determining the contribution of VECs in developmental and disease processes.

쥐과 밸브 내피 세포의 분리

Normal valve structures consist of stratified layers of specialized extracellular matrix (ECM) interspersed with valve interstitial cells (VICs) and ...

Quantitation of Endothelial Cell Adhesiveness In Vitro

One of the cardinal processes of inflammation is the infiltration of immune cells from the lumen of the blood vessel to the surrounding tissue. This occurs when endothelial cells, which line blood vessels, become adhesive to circulating immune cells such as monocytes. In vitro measurement of this adhesiveness has until now been done by quantifying the total number of monocytes that adhere to an endothelial layer either as a direct count or by indirect measurement of the fluorescence of adherent monocytes. While such measurements do indicate the average adhesiveness of the endothelial cell population, they are confounded by a number of factors, such as cell number, and do not reveal the proportion of endothelial cells that are actually adhesive. Here we describe and demonstrate a method which allows the enumeration of adhesive cells within a tested population of endothelial monolayer. Endothelial cells are grown on glass coverslips and following desired treatment are challenged with monocytes (that may be fluorescently labeled). After incubation, a rinsing procedure, involving multiple rounds of immersion and draining, the cells are fixed. Adhesive endothelial cells, which are surrounded by monocytes are readily identified and enumerated, giving an adhesion index that reveals the actual proportion of endothelial cells within the population that are adhesive.

Quantitation of Endothelial Cell Adhesiveness In Vitro

We report an in vitro method that allows the quantitation of the actual number of adhesive cells within an endothelial cell monolayer.

내피 세포 접착 정량<em&gt; 체외</em

One of the cardinal processes of inflammation is the infiltration of immune cells from the lumen of the blood vessel to the surrounding tissue. This ...

Isolation and Primary Culture of Mouse Aortic Endothelial Cells

The vascular endothelium is essential to normal vascular homeostasis. Its dysfunction participates in various cardiovascular disorders. The mouse is an important model for cardiovascular disease research. This study demonstrates a simple method to isolate and culture endothelial cells from the mouse aorta without any special equipment. To isolate endothelial cells, the thoracic aorta is quickly removed from the mouse body, and the attached adipose tissue and connective tissue are removed from the aorta. The aorta is cut into 1 mm rings. Each aortic ring is opened and seeded onto a growth factor reduced matrix with the endothelium facing down. The segments are cultured in endothelial cell growth medium for about 4 days. The endothelial sprouting starts as early as day 2. The segments are then removed and the cells are cultured continually until they reach confluence. The endothelial cells are harvested using neutral proteinase and cultured in endothelial cell growth medium for another two passages before being used for experiments. Immunofluorescence staining indicated that after the second passage the majority of cells were double positive for Dil-ac-LDL uptake, Lectin binding, and CD31 staining, the typical characteristics of endothelial cells. It is suggested that cells at the second to third passages are suitable for in vitro and in vivo experiments to study the endothelial biology. Our protocol provides an effective means of identifying specific cellular and molecular mechanisms in endothelial cell physiopathology.

The vascular endothelial cells play a significant role in many important cardiovascular disorders. This article describes a simple method to isolate and expand endothelial cells from the mouse aorta without using any special equipment. Our protocol provides an effective means of identifying mechanisms in endothelial cell physiopathology.

분리 및 마우스 대동맥 내피 세포의 차 문화

The vascular endothelium is essential to normal vascular homeostasis. Its dysfunction participates in various cardiovascular disorders. The mouse is an ...

세포 단일 층의 기계적 자극에 의​​한 칼슘 웨이브 전파 : 소 각막 내피 세포의 예

세포 단일 층의 기계적 자극에 의한 칼슘 웨이브 전파 : 소 각막 내피 세포의 예