وأيد أعمال البحث التي أجريت في المختبر من المنح المقدمة من مؤسسة أبحاث - فلاندرز (FWO؛ أرقام منحة G.0545.08 وG.0298.11)، وبين الجامعات الجذب برنامج البولنديين (سياسة العلوم البلجيكي؛ منح عدد P6/28 وP7/13) ومضمن في الأوساط البحثية FWO المدعومة. CDH هو زميل ما بعد الدكتوراه من مؤسسة البحوث - فلاندرز (FWO). المؤلفون ممتنون جدا لجميع الأعضاء الحاليين والسابقين في مختبر الجزيئية والخلوية اشارة (جامعة لوفين الكاثوليكية)، د. SP سرينيفاس (مدرسة جامعة إنديانا في علم البصريات، الولايات المتحدة الأمريكية)، ومختبر الدكتور Leybaert (جامعة غنت) ولل د. Vinken (VUB) الذين قدموا مناقشات مفيدة، إلى أقصى حد أو الإجراءات شاركوا في تطوير أدوات لدراسة hemichannels connexin.

1. عزل الخلايا البطانية القرنية قبل الشروع في العمل: عزل الخلايا من العيون العذبة، التي تم الحصول عليها من مسلخ المحلية، في أقرب وقت ممكن بعد enucleating العين. تأكد من أن العين كانت منزوعة النواة من بقرة القصوى 18 شهرا من العمر، خمس دقائق بعد الوفاة والحفاظ عليها في محلول الملح المتوازن ايرل - 1٪ محلول اليود عند 4 درجة مئوية لمدة النقل إلى المختبر. <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> تأخذ العين من محلول الملح المتوازن وايرل - 1٪ محلول اليود ووضعه في طبق بيتري (100 × 20 مم). </li><li style=";text-align:right;direction:rtl"> تعقيم العين مع محلول يحتوي على 70٪ من الإيثانول وشطف مع محلول الملح المتوازن ايرل تحتوي على 1٪ اليود. </li><li style=";text-align:right;direction:rtl"> من هذه الخطوة على، والعمل في غطاء العقيمة. تشريح بعناية القرنية من العين ووضعه في طبق بتري (35 × 10 مم) التي تحتوي على محلول الملح المتوازن ايرل، مع طبقة الخلايا الظهارية التي تواجه التصاعدي. بعناية إزالة أي قزحية STI الأنسجة المتبقيةليرة لبنانية تعلق على القرنية إذا لزم الأمر. </li><li style=";text-align:right;direction:rtl"> نقل القرنية لمحلول الملح المتوازن ايرل آخر تحتوي على طبق بيتري مع طبقة الخلايا البطانية التصاعدي وشطف مرتين مع محلول الملح المتوازن ايرل. </li><li style=";text-align:right;direction:rtl"> نقل القرنية مع الطبقة البطانية التي تواجه التصاعدي إلى الرملية، وهو طبق على شكل كوب، وتغطية ذلك مع متوسط ​​النمو. يتكون المتوسطة نمو متوسطة Dulbecco في التعديل النسر يحتوي على 25 الجلوكوز ملي، و 10٪ مصل بقري جنيني، 6.6٪ L-الجلوتامين، 2.5 ميكروغرام / مل الأمفوتريسين-B، و 1٪ خليط مضاد حيوي مضاد فطري تحتوي على 10،000 وحدة / مل من البنسلين، 10،000 ميكروغرام / مل من الستربتوميسين، و 25 ميكروغرام / مل الأمفوتريسين B. </li><li style=";text-align:right;direction:rtl"> إزالة المتوسطة مع ماصة الشفط. </li><li style=";text-align:right;direction:rtl"> تطبيق 300 ميكرولتر من محلول التربسين (0.5 غرام / لتر) إلى الطبقة البطانية للقرنية (يتم الانتهاء من جميع الخطوات التي تشمل التربسين باستخدام نفس التركيز). </li><li style=";text-align:right;direction:rtl"> وضع الساعة الرملية التي تحتوي على القرنية في طبق بيتري تغطيتها ووضعها في المؤتمر الوطني العراقيubator لمدة 30 دقيقة عند 37 درجة مئوية و 5٪ CO 2. </li><li style=";text-align:right;direction:rtl"> كشط بلطف الخلايا البطانية بعيدا عن القرنية مع مصقول النار هوك على شكل الزجاج ماصة باستير في غطاء العقيمة. </li><li style=";text-align:right;direction:rtl"> تمتص قبالة محلول يحتوي على الخلايا البطانية وإضافته إلى قوارير الثقافة (25 سم 2) تحتوي على 4 مل من مستنبت. </li><li style=";text-align:right;direction:rtl"> تطبيق 300 ميكرولتر من متوسط ​​النمو إلى القرنية وتكرار تجريف وإضافة محلول يحتوي على الخلايا البطانية للقارورة الثقافة. </li><li style=";text-align:right;direction:rtl"> كرر هذه الخطوة الأخيرة (1.11) مرة أخرى. </li><li style=";text-align:right;direction:rtl"> وضع الثقافة قوارير تحتوي على الخلايا البطانية القرنية في متوسط ​​النمو في الحاضنة عند 37 درجة مئوية و 5٪ CO 2. </li><li style=";text-align:right;direction:rtl"> بعد يومين، إضافة 6 مل من مستنبت. </li><li style=";text-align:right;direction:rtl"> تحديث المتوسطة النمو كل يوم الثاني. </li></ol> 2. الثقافة الخلية <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> إزالة مستنبت وغسل الخلايا مرتين مع محلول الملح المتوازن ايرل، وعندما يتم التوصل confluency (داخل ابوT 10 أيام بعد العزلة). </li><li style=";text-align:right;direction:rtl"> إضافة 1.5 مل من محلول التربسين إلى الخلايا لفصل بينها ووضع القارورة في الحاضنة (37 درجة مئوية، 5٪ CO 2) لمدة 3 إلى 4 دقائق. </li><li style=";text-align:right;direction:rtl"> إضافة 12 مل من وسط النمو. ماصة متوسطة ثلاث مرات الدخول والخروج لتفريق الخلايا وعدد الخلايا. </li><li style=";text-align:right;direction:rtl"> بذور الخلايا مع جزء متغير تبعا لكثافة الخلايا ووضعها في الحاضنة. إعداد شريحتين جيدا حجرات (بمساحة 4.2 سم 2) مع عدد خلايا من خلايا 165،000 (39،286 كثافة الخلايا لكل سم 2). إعداد 80 سم 2 قوارير الثقافة لمرور جديدة في مناطق ذات كثافة من 6،250 لكل سم 2، وإضافة مستنبت الطازجة تصل إلى وحدة تخزين ما مجموعه 25 مل. </li><li style=";text-align:right;direction:rtl"> تحديث المتوسطة كل يومين. </li><li style=";text-align:right;direction:rtl"> يتم التوصل Confluency من طبقة الخلايا بعد 3 إلى 4 أيام. استخدام الخلايا لإجراء التجارب. </li><li style=";text-align:right;direction:rtl"> عندما يتم التوصل confluency من طبقة الخلايا في قوارير، كرر الخطوات من 2،1-2،6. مزارع الخلايا يصل إلى مرور 2 يمكن استخدامها جمعةأو التجارب. </li></ol> 3. التحفيز الميكانيكي لإحداث موجة الكالسيوم <ol style=";text-align:right;direction:rtl"><li style=";text-align:right;direction:rtl"> تحميل الخلايا في الشريحة حجرات مع 10 ميكرومتر فلوو-4 صباحا في الفوسفات مخزنة المالحة لمدة 30 دقيقة عند 37 درجة مئوية في حين تهز بلطف. </li><li style=";text-align:right;direction:rtl"> إزالة فلوو-04:00 حل، وغسل الخلايا خمس مرات مع الفوسفات مخزنة المالحة، احتضان الخلايا مع الفوسفات مخزنة المالحة وترك الخلايا لمدة لا تقل عن 5 دقائق في درجة حرارة الغرفة قبل القياس. </li><li style=";text-align:right;direction:rtl"> تثير في 488 نانومتر مع الأرجون ليزر واستخدام شعاع الخائن HFT 488، وجمع الانبعاثات مضان في 530 نانومتر باستخدام longpass الانبعاثات مرشح LP 505، تعيين الثقب في الحد الأدنى. استخدام الغمر 40X الهدف النفط (هواء، 1.2 NA). في التجارب مع ARL-67156، واستخدام الهدف 10X (هواء، 0.3 NA). </li><li style=";text-align:right;direction:rtl"> بحث عن حقل في الخلايا التي هي متكدسة على المجهر متحد البؤر. </li><li style=";text-align:right;direction:rtl"> موقف ماصة بحيث يكون في 45 درجة فيما يتعلق الشريحة حجرات ولمس غشاء الخلية.إثارة (≈ 1 ثانية) التحفيز الميكانيكي قصيرة إلى خلية واحدة. يتكون التحفيز الميكانيكي ل، تشوه قصيرة الأمد الحاد للخلية عن طريق لمس لفترة وجيزة أقل من 1٪ من غشاء الخلية مع micropipette الزجاج (قطر الحافة &lt;1 ميكرون) بالإضافة إلى nanopositioner الكريستال كهرضغطية، تعمل من خلال مكبر للصوت الذي هو شنت على الصغرى مناور. مصنوعة بال micropipettes الزجاج مع ساحبة مسرى مكروي. تأكد من أن nanopositioner تشغلها الجهد بين 0.2 و 1.5 V خلال التحفيز الميكانيكي. A الجهد أعلى من 1.5 V يمكن أن يؤدي إلى تلف الخلايا. لكل نوع من الخلايا وحالة، والجهد الأمثل لتحفيز الميكانيكية دون تلف الخلايا يجب أن تحدد بعناية من خلال تطبيق سلسلة من الفولتية المنخفضة بدءا من (0.2 V) على ارتفاع (1.5 V) الجهد. الجهد هو مقياس لقوة من التحفيز منذ هذا الجهد يحدد إجهاد والتوتر التي يتم تطبيقها على غشاء الخلية. الويمكن حساب قوة من التحفيز الميكانيكي عن طريق ضرب إجهاد ميكانيكي مع المنطقة. نظرا لأن كلا من منطقة (&lt;3.14 ميكرون 2) والضغط الميكانيكية هي منخفضة جدا، وقوة من التحفيز الميكانيكي منخفضة. (لاحظ أنه عند تلف خلية، التسريبات مضان الخروج من الخلية والخلية يتحول الظلام.) </li><li style=";text-align:right;direction:rtl"> قياس التغيرات المكانية في [كا 2 +] ط أعقاب التحفيز الميكانيكي مع المجهر متحد البؤر. </li><li style=";text-align:right;direction:rtl"> جمع وتخزين الصور. </li><li style=";text-align:right;direction:rtl"> رسم المنطقة المضلعة من مصلحة لتحديد مساحة السطح الكلي للخلايا مستجيبة (منطقة نشطة، AA) باستخدام البرنامج من المجهر متحد البؤر. </li></ol>

الكتاب ليس لديهم ما يكشف.

في هذا المخطوط، ونحن تصف طريقة بسيطة لقياس بين الخلايا كا 2 + انتشار الموجة في الطبقات الوحيدة من الأبقار الخلايا البطانية القرنية الأولية عن طريق توفير التحفيز الميكانيكي المترجمة والتي تسيطر عليها باستخدام micropipette. الخلايا حفز ميكانيكيا الاستجابة مع زيادة المحلية في مجال الملكية الفكرية داخل الخلايا 3 والكالسيوم 2 +، وكلاهما جزيئات إشارات بين الخلايا الأساسية التي تدفع بين الخلايا كا 2 + موجة انتشار 11،67. IP 3 يتم نقل مباشرة إلى الخلايا المجاورة عبر قنوات تقاطع الفجوة 5، بينما كا 2 + يثير افتتاح hemichannels والإفراج عن ATP 68،69، التي يطلق كا 2 + إشارات في الخلايا المجاورة من خلال تفعيل البروتين يقترن G-P2 المستقبلات 37-40. ويمكن وصف المساهمة النسبية للقنوات تقاطع الفجوة وhemichannels في هذه العملية عن طريق استخدام المحاكاة CX-الببتيدات، والانزيمات ATP-المهينة (ectonucleotidases) ومثبطات ectonucleotisdases. خصائص ميكانيكية التحفيز التي يسببها بين الخلايا كا 2 + انتشار الموجة في الأبقار الخلايا البطانية القرنية اتسمت بدقة في مختبرنا 25-33. تشير نتائجنا إلى أن بين الخلايا كا 2 + انتشار الموجة مدفوعة أساسا عن طريق إطلاق CX-hemichannel بوساطة من ATP، مع Cx43 لعب دورا بارزا. على هذا النحو، وهذه الطريقة تطبق على الأبقار الخلايا البطانية القرنية الأساسي هو مناسبة خاصة لتحديد أو توصيف تنظيم Cx43 hemichannels على المستويات المحلية في الخلايا الأصلية. باستخدام هذا الأسلوب، وقد وجدنا أن نشاط Cx43 hemichannels يتم التحكم حاسمة من قبل الهيكل الخلوي أكتوميوزين، والتي قد تكون بمثابة الفرامل الذاتية منع المفرط، وبالتالي مؤذية، Cx43 hemichannel افتتاح 25،31،32. نحن كذلك توضيح الآليات الجزيئية الكامنة وراء هذا التنظيم والعثور علىدورا هاما من داخل الجزيء التفاعلات حلقة / الذيل التي لا غنى عنها لافتتاح Cx43 hemichannels 33. ومن الواضح أن هذا النظام هو مناسبة جدا لدراسة وظيفة من القنوات تقاطع الفجوة معادل والمستندة إلى Panx وhemichannels وبالتأكيد لا تقتصر على الأبقار الخلايا البطانية القرنية ولكن قابلة للتكيف مع الواقع أي نوع من الخلايا والأنسجة أيضا أكثر تعقيدا، كما لم تظهر في الدماغ حيث أثار التحفيز الميكانيكي بين الخلايا كا 2 + كبير موجات تشمل نصف الكرة الأرضية بأكمله 70. أدوات مختلفة موجودة لتقييم مساهمة القنوات وhemichannels تقاطع الفجوة، بما في ذلك الببتيدات CX-المحاكاة، والانزيمات ATP-المهينة، مثبطات ectonucleotidases والمركبات الدوائية مثل كربينوكسولون و 10 Panx1 (الجدول 2) 49،50. لتحديد مساهمة معينة أو معادل Panx الإسوي في هذه العملية، تحقيقات سيرنا مصممة بعناية رargeting منطقتين مستقلة عن مرنا والتحكم المخفوق ينبغي استخدامها. وينبغي أن تحدد مدى ضربة قاضية في مستوى البروتين الكلي باستخدام-النشاف الغربية المقايسات ومستوى خلية واحدة باستخدام المجهر الفلورسنت. وينبغي تقييم كفاءة ترنسفكأيشن من تحقيقات سيرنا في الخلية monolayers تجريبية بواسطة المجهر الفلورسنت. لهذا، يمكن للمرء وضع سيرنا دوبلكس في التي أدمجت تسمية الفلورسنت في نهاية 3 &#39;من ضفيرة معنى. ومن المهم أن نلاحظ أن للتحليل السليم، تخفيض بارز في معادل أو Panx الإسوي (&gt; تخفيض 90٪)، فضلا عن ترنسفكأيشن متجانسة من دوبلكسات سيرنا في أحادي الطبقة الخلية (&gt; 90٪ من الخلايا transfected مع سيرنا مسبار) ينبغي الحصول عليها. ينبغي تقييم الانتقائية للتحقيقات سيرنا مصممة نحو تحقيق هدف 71. وباختصار، ينبغي التحقق من صحة هذه الأدوات بحيث لا تؤثر على التعبير عن معادل أو غيرها من الأشكال الإسوية Panx أو غيرها كوم الرئيسية* مكونات القيادة بين الخلايا كا 2 + موجات، مثل P2X أو P2Y المستقبلات. لتقييم مساهمة Cx43 hemichannels، لدينا تعاون مع مختبر الدكتور Leybaert في تطوير الببتيد خلية قابلة للاختراق الموافق النصف الثاني من الحلقة داخل الخلايا من Cx43 (TAT-L2) التي تعمل بمثابة انتقائية، المانع من امكانات Cx43 hemichannels مع الحفاظ على Cx43 الفجوة تقاطع نشاط قناة 33. في دراساتنا، ونحن نستخدم 100 ميكرومتر TAT-L2 للحصول على تثبيط كامل للCx43 hemichannels، ولكن تركيزات أقل قد تكون كافية 72. ينصح TAT-L2H126K/I130N كعنصر تحكم السلبية 73. لتقييم مساهمة Panx1 القنوات، يمكن تطبيق الببتيد 10Panx1. هذه الأدوات ليست مهمة فقط لاستبعاد البلازما تعطيل غشاء (انظر أدناه)، ولكن أيضا لإثبات أن نظير الصماوي ATP يتوسط يشير آليات بين الخلايا كا 2 + انتشار الموجة التي كتبها hemichannels وليس عن طريق آليات أخرى (مثل مقنوات AXI-أنيون أو الإفراج عن الحويصلات المحتوية على ATP-). أخيرا، وكما لجميع الدراسات التي تستخدم الخلايا الأولية، يجب على الظروف ثقافة الخلية وعدد من المقاطع تكون موحدة، كما الخصائص البيولوجية للخلايا وبالتالي قد تغيير الوضع التعبير عن مختلف معادل والإسوية Panx مع مرور الوقت 26. ومع ذلك، هناك عدد من المآخذ على هذه الطريقة. والعيب الرئيسي لهذه الطريقة أن التحفيز الميكانيكي قد تؤدي إلى اضطراب غشاء البلازما، مما أدى إلى دخول الخلية كا 2 + والإفراج عن الجزيئات يشير مثل ATP، وكلاهما تكمن وراء حسن النية بين الخلايا كا 2 + موجة الانتشار 11. هذا يعقد بالتأكيد التحليل (كمي) من الكالسيوم بين الخلايا 2 + الموجة. ولذلك، فمن المستحسن جدا أن واحدة ينبغي ط) استخدام الضوابط المناسبة، أي خطوط الخلايا التي تفتقر إلى التعبير عن معادل أو الإسوية Panx، والأدوات التي الأسواق العالمية ضغطهاrfere مع وظيفة معادل وPanx كقنوات الفجوة مفرق و / أو hemichannels والثاني) توحيد إجراءات التحفيز الميكانيكي (تأكد أنه خلال التحفيز الميكانيكي يتم تشغيل nanopositioner من الجهد ما بين 0.5 و 2 V). وعلاوة على ذلك، فمن المهم أن نلاحظ أن هذا الأسلوب لا يقف في حد ذاته، ولكن ينبغي أن ترتكز على نهج تجريبية إضافية لدراسة قنوات معادل وPanx. ويمكن تحقيق ذلك باستخدام الزيادة المحلية من الجزيئات داخل الخلايا مما يشير أن تشارك في آلية التحفيز بوساطة بين الخلايا كا 2 + انتشار الموجة، مثل uncaging الملكية الفكرية داخل الخلايا 3 أو كا 2 + 11،74. لبدء بين الخلايا كا 2 + الموجة مستقلة من التحفيز الميكانيكي، يمكن للمرء استخدام الحقن الصغيرة، مثل المؤتلف باكس الموالية لأفكارك 11،75 والصور activatable كا 2 +-مخازن مثل ديازو 2 أن يؤدي إلى انخفاض المحلية في خارج الخلية [كا 2 + </سوب&gt;] 76، مشغل معروف لفتح hemichannel. بدلا من ذلك، يمكن للمرء استخدام electroporation الموقع من جزيئات إشارة الخلية كتيمة في أن تؤدي الخلايا كا 2 + الإصدار وبين الخلايا كا 2 + موجات، مثل IP 3 67،68. يتم استخدام الأسلوب الأخير أيضا للتحقيق في انتشار موت الخلية 5،77. وتوفر هذه المحفزات غير الميكانيكية إجراء تقييم أفضل من التحفيز كثافة والاستجابة. وبالإضافة إلى هذه الأساليب 2 + انتشار الموجة الكالسيوم، فمن المهم لتحديد النشاط من القنوات معادل أو Panx باستخدام المناهج الأخرى، بما في ذلك تحديد ماء امتصاص الصبغة (مثل لوسيفر الأصفر) 78 والإفراج عن ATP ليس فقط في ردا على التحفيز الميكانيكي ولكن أيضا في الاستجابة إلى خارج الخلية كا 2 +-مخازن (مثل EGTA) وبين الخلايا كا 2 + الافراج عن جزيئات (مثل كا 2 +-A23187 حامل الأيون) 11،74. وبالإضافة إلى ذلك، رانه خير دليل لتنظيم على مستوى القناة يتم توفيرها من قبل التجارب الكهربية، إما نظم المشبك الجهد المزدوج أو المشبك مسار كامل الخلية من البويضات القيطم حقنوا معادل أو Panx مرنا أو من خلايا هيلا معربا عن ectopically الإسوية معادل معا مع علامة مثل GFP 79-84. وفي الختام، واستخدام التحفيز الميكانيكي لإحداث بين الخلايا كا 2 + موجات يوفر طريقة بسيطة وموثوق بها للتحقيق الاتصال بين الخلايا ودراسة مساهمة وخصائص القنوات معادل وPanx.

الاتصالات بين الخلايا وإشارات ضرورية لتنسيق العمليات الفسيولوجية في استجابة لمنبهات خارج الخلية في الأنسجة و1،2 مستوى كامل الجهاز. يتم إنشاء الطريق الأكثر مباشرة للاتصال بين الخلايا من حدوث تقاطعات الفجوة. تقاطعات الفجوة هي لويحات من القنوات تقاطع الفجوة، والتي هي القنوات البروتينية التي شكلتها لرسو السفن وجها لوجه من اثنين connexin (CX) hemichannels من الخلايا المتجاورة 3،4 (الشكل 1). تقاطعات الفجوة تسمح بمرور الجزيئات الصغيرة إشارة ذات وزن جزيئي أقل من 1.5 كيلو دالتون، بما في ذلك كا 2 + 3 5 أو IP، مما تسبب في وتحوير كا 2 + الإفراج من المخازن داخل الخلايا من الخلايا المجاورة 6 (الشكل 2). قنوات تقاطع الفجوة وينظم بإحكام بواسطة البينية بين الجزيئات والتفاعلات البروتين والعمليات مما يشير الخلوية، مثل تعديل الأكسدة والفسفرة 7. GJS تسهيل الاستجابة المنسقة من الخلايا متصلة، فيعمل كمادة كيميائية ومخلى الكهربائية. على سبيل المثال، انتشار إمكانات العمل القلب عبر myocytes الأذيني البطيني ويتم بوساطة قنوات GJ المستندة إلى معادل 85. CXS يكن لديك سوى دور كقنوات تقاطع الفجوة، ولكن أيضا تشكيل hemichannels المفردة، وبالتالي تعمل كقنوات في الأغشية على نحو مماثل لقنوات ايون العادية 8-10 (الشكل 1). المشاركة Hemichannels في إشارة نظير الصماوي بين الخلايا المجاورة عن طريق التحكم في تبادل الأيونات والجزيئات يشير بين البيئة داخل وخارج الخلية. في العديد من أنواع الخلايا (مثل الخلايا الظهارية وخلايا بانية للعظم، الخلايا النجمية والخلايا البطانية، وغيرها) وأجهزة (مثل الدماغ والكبد وشبكية العين، القوقعة والأوعية الدموية)، بين الخلايا كا 2 + موجات أساسية لتنسيق الاستجابات المتعددة الخلايا <suP&gt; 11. الزيادات في داخل الخلايا كا 2 + المستويات في خلية معينة لا تقتصر على هذه الخلية، ولكن تنتشر إلى الخلايا المجاورة المحيطة بها، وبالتالي إنشاء الكالسيوم بين الخلايا 2 + الموجة 12،13. هذه بين الخلايا كا 2 + موجات مهمة لتنظيم فسيولوجية طبيعية من طبقات الخلايا باعتبارها مخلى وارتبط التقلبات مع العمليات الفيزيولوجية المرضية 11. في بطانة القرنية وظهارة، مجموعات مختلفة 14-24، بما في ذلك منطقتنا 25-33، ودرس آليات وأدوار الاتصالات بين الخلايا. في الخلايا غير منفعل، مثل الخلايا البطانية القرنية، واثنين من وسائط مختلفة من الاتصالات بين الخلايا تحدث 28،29، وهي فجوة التواصل بين الخلايا صلي والاتصالات بين الخلايا نظير الصماوي. ينطوي على فجوة الاتصال بين الخلايا صلي على التبادل المباشر للجزيئات إشارة عبر الفجوة التقاطعات 7. الفجوة و Juncالاتصالات بين الخلايا tional أمر بالغ الأهمية للحفاظ على توازن الأنسجة، والسيطرة على تكاثر الخلايا، وإنشاء استجابة المتزامنة للإجهاد خارج الخلية 10،34،35. في عدد من الحالات المرضية، يتم تقليل الفجوة اقتران تقاطع بسبب CXS المعيبة، والتي تؤثر بهذا الفجوة صلي الاتصالات بين الخلايا 36. وهذا يؤكد أهمية وتأثير فجوة الاتصال بين الخلايا صلي في الكائنات متعددة الخلايا. وعلى النقيض من فجوة الاتصال بين الخلايا صلي والاتصالات بين الخلايا نظير الصماوي ليست متوقفة على بدل خلية خلية، لأنه ينطوي على الافراج عن رسل خارج الخلية إنتشاري (الشكل 2). يتم إطلاق أنواع مختلفة من الجزيئات يشير في الفضاء خارج الخلية عن طريق إشارات الخلايا. ثم يتم نقل جزيء إلى الخلية المستهدفة حيث يتم الكشف عنها بواسطة بروتين مستقبلات محددة. وفي وقت لاحق مجمع مستقبلات إشارة يؤدي الى استجابة الخلوية، التييتم إنهاء عن طريق إزالة إشارة، تعطيل أو إزالة التحسس. صدر محبة للدهون رسل إشارة خارج الخلية اختراق الغشاء وتعمل على مستقبلات الخلايا. في المقابل، رسل ماء لا عبور الغشاء البلازمي للخلية الاستجابة، ولكن بمثابة يجند التي تربط لسطح أعرب البروتينات المستقبلة، التي تتابع بعد ذلك إشارة إلى البيئة داخل الخلايا. ثلاث عائلات رئيسية من البروتينات مستقبلات سطح الخلية المشاركة في هذه العملية: ايون قناة مرتبطة، المرتبط بالإنزيم، وربط بروتين G. الجزيء رسول صدر يمكن أن تعمل على المستقبلات من نفس الخلية (autocrine)، على الخلايا المستهدفة على مقربة (نظير الصماوي)، أو على الخلايا المستهدفة البعيدة التي تتطلب نظام الدورة الدموية (الغدد الصماء). في العديد من أنواع الخلايا، بما في ذلك بطانة القرنية 28،29، ATP هو واحد من عوامل نظير الصماوي ماء الرئيسية التي تدفع انتشار بين الخلايا كا 2 + موجات 37-40. الدرجي تشوه الميكانيكية، نقص الأكسجة، التهاب أو التحفيز من قبل وكلاء مختلف، ATP يمكن أن تنطلق من الخلايا السليمة 41-44 استجابة لإجهاد القص، وتمتد، أو ناضح تورم 44،45. وقد افترض آليات ATP-الافراج مختلفة، بما في ذلك إيماس حويصلي 44 وعدد كبير من آليات النقل، مثل راديو كاسيت ATP ملزم (ABC) الناقلون، قنوات أنيون التي تعتمد على الجهد البلازمي 46، P2X7 قنوات مستقبلات 47،48، وكذلك hemichannels connexin 49-52 وhemichannels pannexin 43،49،53. ATP خارج الخلية يمكن ان تحلل بسرعة إلى ADP، AMP والأدينوساين 54،55 من قبل ectonucleotidases التي تكون موجودة في البيئة خارج الخلية. سوف ATP صدر خارج الخلية والمستقلب ADP 56 ينتشر عن طريق نشرها. وقد تورط التفاعل اللاحقة من هذه النيوكليوتيدات مع مستقبلات purinergic في الخلايا المجاورة في عropagation من بين الخلايا كا 2 + موجات 28،37،51. فئتين مختلفتين من المستقبلات purinergic موجودة: الأدينوزين هو يجند الطبيعية الرئيسية لP1-purinoceptors، في حين أن كلا البيورين (ATP، ADP) وبيريميدين (UTP، UDP) النيوكليوتيدات تعمل على معظم P2-purinoceptors 57. الاتصالات بين الخلايا يمكن التحقيق من قبل وسائل مختلفة مثل تحميل كشط، ونقل صبغ، uncaging المحلية من منبهات مثل IP 3 والكالسيوم 2 +، التحفيز الميكانيكي، الخ. نحن هنا وصف دراسة كا 2 + موجة الانتشار التي تسببها التحفيز الميكانيكي من خلية واحدة. الاستفادة من دراسة كا 2 + انتشار الموجة عن طريق التحفيز الميكانيكي هو أنه يوفر أداة سهلة لقياس انتشار كا 2 + الموجة مع مرور الوقت وأنه يسمح بمقارنة كميا المعالجة المسبقة مختلفة من الخلايا. في بطانة القرنية، وهذه كا 2 + بين الخلايا موجات تسمح لشركةاستجابة منسقة من أحادي الطبقة، وهو يتصرف بموجب كآلية دفاع ممكن من بطانة القرنية غير التجدد مساعدة البطانة على تحمل الضغوط خارج الخلية أثناء الجراحة داخل العين، أو عند التعرض للالتهابات وسطاء خلال الرفض المناعي أو التهاب القزحية 58،59.

<table border="1">
<tbody>
 <tr>
 <td>Name of Reagent/Material</td>
 <td>Company</td>
 <td>Catalog Number</td>
 <td>Column1</td>
 </tr>
 <tr>
 <td>Earle's Balanced Salt Solution (EBSS)</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>14155-048</td>
 <td></td>
 </tr>
 <tr>
 <td>Iodine</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>38060-1EA</td>
 <td></td>
 </tr>
 <tr>
 <td>Dulbecco's Modified Eagle's Medium (DMEM)</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>11960-044</td>
 <td></td>
 </tr>
 <tr>
 <td>L-glutamine (Glutamax)</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>35050-038</td>
 <td></td>
 </tr>
 <tr>
 <td>Amphotericin-B</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A2942</td>
 <td></td>
 </tr>
 <tr>
 <td>Antibiotic-antimycotic mixture</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>15240-096</td>
 <td></td>
 </tr>
 <tr>
 <td>Trypsin</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>25300-054</td>
 <td></td>
 </tr>
 <tr>
 <td>Dulbecco's PBS</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>14190-091</td>
 <td></td>
 </tr>
 <tr>
 <td>Fluo-4 AM</td>
 <td>Invitrogen-Gibco-Molecular Probes (Karlsruhe, Germany)</td>
 <td>F14217</td>
 <td></td>
 </tr>
 <tr>
 <td>ARL-67156 (6-N,N-Diethyl-b,g-dibromomethylene-D-ATP) </td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A265</td>
 <td></td>
 </tr>
 <tr>
 <td>Apyrase VI</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A6410</td>
 <td></td>
 </tr>
 <tr>
 <td>Apyrase VII</td>
 <td>Sigma-Aldrich (Deisenhofen, Germany)</td>
 <td>A6535</td>
 <td></td>
 </tr>
 <tr>
 <td>Gap26 (VCYDKSFPISHVR)</td>
 <td>Custom peptide synthesis</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>Gap27 (SRPTEKTIFII)</td>
 <td>Custom peptide synthesis</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>Control Peptide (SRGGEKNVFIV)</td>
 <td>Custom peptide synthesis</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>siRNA1 Cx43 (sense: 5'GAAGGAGGAGGAACU-CAAAdTdT) </td>
 <td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>siRNA2 Cx43 (sense: 5'CAAUUCUUCCUGCCGCAAUdTdT) </td>
 <td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>siRNA scramble: scrambled sequence of siCx43-1 (sense: 5'GGUAAACG-GAACGAGAAGAdTdT) </td>
 <td>Annealed siRNA was purchased at Eurogentec (Luik, Belgium)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>TAT-L2 (TAT- DGANVDMHLKQIEIKKFKYGIEEHGK)</td>
 <td>Thermo Electron (Ulm, Germany)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>TAT-L2-H126K/I130N (TAT-DGANVDMKLKQNEIKKFKYGIEEHGK) </td>
 <td>Thermo Electron (Ulm, Germany)</td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td></td>
 <td></td>
 <td></td>
 <td></td>
 </tr>
 <tr>
 <td>Two chambered glass slides</td>
 <td>Laboratory-Tek Nunc (Roskilde, Denmark)</td>
 <td>155380</td>
 <td></td>
 </tr>
 <tr>
 <td>Confocal microscope </td>
 <td>Carl Zeiss Meditec (Jena, Germany)</td>
 <td>LSM510</td>
 <td></td>
 </tr>
 <tr>
 <td>Piezoelectric crystal nanopositioner (Piezo Flexure NanoPositioner)</td>
 <td>PI Polytech (Karlsruhe, Germany)</td>
 <td>P-280</td>
 <td></td>
 </tr>
 <tr>
 <td>HVPZT-amplifier</td>
 <td>PI Polytech (Karlsruhe, Germany)</td>
 <td>E463 HVPZT-amplifier</td>
 <td></td>
 </tr>
 <tr>
 <td>Glass tubes (glass replacement 3.5 nanoliter)</td>
 <td>World Precision Instruments, Inc. Sarasota, Florida, USA</td>
 <td>4878</td>
 <td></td>
 </tr>
 <tr>
 <td>Microelectrode puller </td>
 <td>Zeitz Instrumente (Munchen, Germany)</td>
 <td>WZ DMZ-Universal Puller</td>
 <td></td>
 </tr>
</tbody>
 </table>

mechanical stimulation-induced calcium wave propagation in cell monolayers: the example of bovine corneal endothelial cells

الاتصالات بين الخلايا أمر ضروري لتنسيق العمليات الفسيولوجية بين الخلايا في مجموعة متنوعة من الأجهزة والأنسجة، بما في ذلك الدماغ والكبد، شبكية العين، القوقعة والأوعية الدموية. في إعدادات التجريبية، بين الخلايا كا 2 + موجات يمكن استخلاصها من خلال تطبيق التحفيز الميكانيكي لخلية واحدة. وهذا يؤدي إلى الإفراج عن الجزيئات داخل الخلايا مما يشير IP 3 والكالسيوم 2 + التي بدء انتشار كا 2 + الموجة بتكثف من الخلية حفز ميكانيكيا إلى الخلايا المجاورة. يتم توفير المسارات الجزيئية الرئيسية التي تتحكم بين الخلايا كا 2 + انتشار الموجة عبر قنوات تقاطع الفجوة من خلال نقل مباشر من IP (3) وhemichannels من خلال الافراج عن ATP. ويسمح تحديد وتوصيف خصائص وتنظيم connexin مختلفة والأشكال الإسوية pannexin كقنوات تقاطع الفجوة وhemichannels من قبل quantificatioن من انتشار الكالسيوم بين الخلايا 2 + الموجة، سيرنا، واستخدام مثبطات قنوات تقاطع الفجوة وhemichannels. هنا، نحن تصف طريقة لقياس بين الخلايا كا 2 + الموجة في الطبقات الوحيدة من الخلايا البطانية القرنية الأولية محملة Fluo4-AM ردا على التحفيز الميكانيكي للرقابة والمترجمة استفزاز من قبل، وتشوه قصيرة الأمد الحاد في الخلية نتيجة لذلك من لمس غشاء الخلية مع micropipette الزجاج التي تسيطر عليها مياداة مجهرية التي يبلغ قطرها غيض من أقل من 1 ميكرون. نحن أيضا وصف عزلة الابتدائي الأبقار الخلايا البطانية القرنية واستخدامه كنظام نموذج لتقييم النشاط Cx43-hemichannel باعتبارها القوة يحركها لبين الخلايا كا 2 + موجات من خلال الافراج عن ATP. وأخيرا، نحن مناقشة استخدام، ومزايا والقيود والبدائل لهذا الأسلوب في سياق الفجوة قناة تقاطع والبحوث hemichannel.

Watch this Scientific Journal Video about Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells at JoVE.com

Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells

الكالسيوم بين الخلايا<sup&gt; 2 +</supهي التي تحرك&gt; موجات عبر قنوات تقاطع الفجوة وhemichannels. هنا، نحن تصف طريقة لقياس الكالسيوم بين الخلايا<sup&gt; 2 +</sup&gt; موجات في الخلية monolayers في استجابة لحافز الميكانيكية وحيدة الخلية المحلية وتطبيقه على التحقيق في خصائص وتنظيم قنوات تقاطع الفجوة وhemichannels.

تحفيز الميكانيكية التي يسببها الكالسيوم انتشار الموجات في الخلية monolayers: مثال من الأبقار الخلايا البطانية القرنية

Intercellular communication is essential for the coordination of physiological processes between cells in a variety of organs and tissues, including the ...

mechanical-stimulation-induced-calcium-wave-propagation-cell

Nanyang Technological University

Research

JoVE Journal

Biology

16.2K Views.  KU Leuven. الكالسيوم بين الخلايا 2 + موجات عبر قنوات تقاطع الفجوة وhemichannels. هنا، نحن تصف طريقة لقياس الكالسيوم بين الخلايا 2 + موجات في الخلية monolayers في استجابة لحافز الميكانيكية وحيدة الخلية المحلية وتطبيقه على التحقيق في خصائص وتنظيم قنوات تقا...

Video: Mechanical Stimulation-induced Calcium Wave Propagation in Cell Monolayers: The Example of Bovine Corneal Endothelial Cells

Propagation of Human Embryonic Stem (ES) Cells

Propagation of Human Embryonic Stem ES Cells

Yeah, so I'm Lauren Deon. I'm in charge of the Human Amgen stem cell co facility at MGH. Yeah, so I'm Lauren, I'm in charge of the Human AM stem cell co facility at MGH.So I've been working with human Amgen stem cells for years now since I was a postdoc in George De Lab before, from four, four years. And so right now we have two cell lines, H one and H nine, which are both from Y cell. And so the way we are expanding or maintaining these cells in culture is by, at least the way we are splitting these cells is by using collagenous.So what I usually do is for the first few passage after throwing the cells, I use a technical, the picking colonies. So in this case, I can check under the microscope which colonies are good and differentiate and nice shape, and I will collect only these colonies and I will cut them in few pieces and put them back in, in a fresh flat. And the, the colonies that look kind of differentiate it are just left them alone.The other way to pass the cells is by using trypsin. So I don't use this technique here. I think collagenase is a little bit safer because human being stem cells don't like to be individualized or they don't like to be alone.So if you do trypsin, if you use trypsin for a little bit too long, if you use it for like three to four minutes, which is the way we use strips in for other type of cells, human stem cells will be individualized and most of them will die or just differentiate or will not attach to the myth. So the idea is you have to keep the cells as clumps. You don't want them to be alone in the in, in the flask.So using collagenase, the advantage is to keep cells as plants. Using chipsy, you just select for cells that will survive this very, very harsh process of g opsonization. So these cells are usually very highly proliferative.So you get, you can adapt your cells to this tripsin process. The problem is that you have cells that they behave differently, they go much faster. And one risk is that you can get some commercial abnormality to, to this, to this very high division process.So you say that ization can cause selection of cells in culture for most proliferative cells.Right. More ative and probably also higher survival rates than other cells. So after proliferation, basically culture after proliferation in tripsin, after several passages become a different culture, these different properties.So it's, it's hard to figure out if they are exactly identical. If you do the test, the usual test, let's say you check markers, regular markers of end differentiated cells like OC four, nano one 60 SC four C, C3, all this molecule might still be expressed. If you do TER formation, this cells might still differentiate and be formed like al like normal cells.If you look at the karyotype, you might have some abnormality, but you might still have a normal karyotype. The, the, the selective advantage might be due to just a mutation that you cannot see by doing a karyotype. So the fact that they grow much faster is by itself I think a little bit worser.And if we want to use these cells for transplantation at some point, I would definitely not use this type of cells.Okay. So would you like to tell me what are the main technical problems with using this technique for, for passages of cells? So using S, yes.It's just a little bit longer and also it's, since the cells are not going as fast, it's just much longer to get a high number of cells to do some experiment. So it's just less convenient I would say. Would you like to tell me about few words about the goals of your experiment?How do you use CS cells? Okay, so my main project here is to get endothelial cells from human AB stem cells. And the idea is to be able to make blood.And we are working a lot with tissue bioengineering labs and one of their goal is to make tissue in vitro. But one of the limitation to this is the lack of blood vessels going through this tissues. So if we can bring endothelial cells or put endothelial cells in this tissue, we would have better growth of this tissue.So the idea few sources of cells are known for endothelial cells like cold blood or pressure blood, but it would be interesting to have another source of cells like human years. And the advantage is since human years can be expanded and most infinitely, you could modify these cells, make some inducible system and be able to use it. Then in your final product, your material cells, in this case.

انتشار الخلايا الجنينية البشرية (ES) الجذعية

Isolation and Large Scale Expansion of Adult Human Endothelial Colony Forming Progenitor Cells

This paper introduces a novel recovery strategy for endothelial colony forming progenitor cells (ECFCs) from heparinized but otherwise unmanipulated adult human peripheral blood within a mean of 12 days. After large scale expansion &gt;1x108 ECFCs can be obtained for further tests. Advantageously by using pHPL the contact of human cells with bovine serum antigens can be excluded. By flow cytometry and immunohistochemistry the isolated cells can be characterized as ECFC and their in vitro functionality to form vascular like structures can be tested in a matrigel assay. Further these cells can be subcutaneously injected in a mouse model to form functional, perfused vessels in vivo. After long term expansion and cryopreservation proliferation, function and genomic stability appear to be preserved. 3,4
This animal-protein free isolation and expansion method is easily applicable to generate a large quantity of ECFCs.

Endothelial colony forming progenitor cells (ECFCs) are a promising tool to study vascular homeostasis and repair.1,2 This paper introduces a novel animal-serum free method for isolation and expansion of ECFC from heparinised adult human peripheral blood with pooled human platelet lysate (pHPL) diminishing the risk of anti-bovine immunisation.

العزلة وتوقعات بنمو كبير من الكبار الإنسان خلايا غشائي السلف تشكيل مستعمرة

This paper introduces a novel recovery strategy for endothelial colony forming progenitor cells (ECFCs) from heparinized but otherwise unmanipulated adult ...

Isolation of Valvular Endothelial Cells

Heart valves are solely responsible for maintaining unidirectional blood flow through the cardiovascular system. These thin, fibrous tissues are subjected to significant mechanical stresses as they open and close several billion times over a lifespan. The incredible endurance of these tissues is due to the resident valvular endothelial (VEC) and interstitial cells (VIC) that constantly repair and remodel in response to local mechanical and biological signals. Only recently have we begun to understand the unique behaviors of these cells, for which in vitro experimentation has played a key role. Particularly challenging is the isolation and culture of VEC. Special care must be used from the moment the tissue is removed from the host through final plating. Here we present protocols for direct isolation, side specific isolation, culture, and verification of pure populations of VEC. We use enzymatic digestion followed by a gentle swab scraping technique to dislodge only surface cells. These cells are then collected into a tube and centrifuged into a pellet. The pellet is then resuspended and plated into culture flasks pre-coated with collagen I matrix. VEC phenotype is confirmed by contact inhibited growth and the expression of endothelial specific markers such as PECAM1 (CD31), Von Willebrand Factor (vWF), and negative expression of alpha-smooth muscle actin (&alpha;-SMA). The functional characteristics of VEC are associated with high levels of acetylated LDL. Unlike vascular endothelial cells, VEC have the unique capacity to transform into mesenchyme, which normally occurs during embryonic valve formation1. This can also occur during significantly prolonged post confluent in vitro culture, so care should be made to passage at or near confluence. After VEC isolation, pure populations of VIC can then be easily acquired.

We provide a method for isolating and culturing pure populations of heart valve endothelial cells (VEC). VEC can be isolated from either side of the cusp or leaflet and immediately following, underlying interstitial cell (VIC) isolation is straightforward.

عزل الخلايا البطانية صمامي

Heart valves are solely responsible for maintaining unidirectional blood flow through the cardiovascular system.  These thin, fibrous tissues are ...

Assessment of Calcium Sparks in Intact Skeletal Muscle Fibers

Maintaining homeostatic Ca2+ signaling is a fundamental physiological process in living cells. Ca2+ sparks are the elementary units of Ca2+ signaling in the striated muscle fibers that appear as highly localized Ca2+ release events mediated by ryanodine receptor (RyR) Ca2+ release channels on the sarcoplasmic reticulum (SR) membrane. Proper assessment of muscle Ca2+ sparks could provide information on the intracellular Ca2+&#160;handling properties of healthy and diseased striated muscles. Although Ca2+ sparks events are commonly seen in resting cardiomyocytes, they are rarely observed in resting skeletal muscle fibers; thus there is a need for methods to generate and analyze sparks in skeletal muscle fibers.
Detailed here is an experimental protocol for measuring Ca2+ sparks in isolated flexor digitorm brevis (FDB) muscle fibers using fluorescent Ca2+ indictors and laser scanning confocal microscopy. In this approach, isolated FDB fibers are exposed to transient hypoosmotic stress followed by a return to isotonic physiological solution. Under these conditions, a robust Ca2+ sparks response is detected adjacent to the sarcolemmal membrane in young healthy FDB muscle fibers. Altered Ca2+ sparks response is detected in dystrophic or aged skeletal muscle fibers. This approach has recently demonstrated that membrane-delimited signaling involving cross-talk between inositol (1,4,5)-triphosphate receptor (IP3R) and RyR contributes to Ca2+ spark activation in skeletal muscle. In summary, our studies using osmotic stress induced Ca2+ sparks showed that this intracellular response reflects a muscle signaling mechanism in physiology and aging/disease states, including mouse models of muscle dystrophy (mdx mice) or amyotrophic lateral sclerosis (ALS model).

Described here is a method to directly measure calcium sparks, the elementary units of Ca2+ release from sarcoplasmic reticulum&#160;in intact skeletal muscle fibers. This method utilizes osmotic-stress-mediated triggering of Ca2+ release from ryanodine receptor in isolated muscle fibers. The dynamics and homeostatic capacity of intracellular Ca2+ signaling can be employed to assess muscle function in health and disease.

تقييم الكالسيوم سباركس السليمة في ألياف العضلات الهيكلية

Maintaining homeostatic Ca2+ signaling is a fundamental physiological process in living cells. Ca2+ sparks are the elementary units of Ca2+ signaling in ...

Endothelial Cell Tube Formation Assay for the In Vitro Study of Angiogenesis

Angiogenesis is a vital process for normal tissue development and wound healing, but is also associated with a variety of pathological conditions. Using this protocol, angiogenesis may be measured in vitro in a fast, quantifiable manner. Primary or immortalized endothelial cells are mixed with conditioned media and plated on basement membrane matrix. The endothelial cells form capillary like structures in response to angiogenic signals found in conditioned media. The tube formation occurs quickly with endothelial cells beginning to align themselves within 1&#160;hr and lumen-containing tubules beginning to appear within 2 hr. Tubes can be visualized using a phase contrast inverted microscope, or the cells can be treated with calcein AM prior to the assay and tubes visualized through fluorescence or confocal microscopy. The number of branch sites/nodes, loops/meshes, or number or length of tubes formed can be easily quantified as a measure of in vitro angiogenesis. In summary, this assay can be used to identify genes and pathways that are involved in the promotion or inhibition of angiogenesis in a rapid, reproducible, and quantitative manner.

Endothelial Cell Tube Formation Assay for the In Vitro Study of Angiogenesis

The tube formation assay is a fast, quantifiable method for measuring in vitro angiogenesis. Endothelial cells are combined with conditioned media and plated on basement membrane extract. Tube formation occurs within hours and newly formed tubules easily quantified.

البطانية أنبوب تشكيل خلية الفحص ل<em&gt; في المختبر</em&gt; دراسة الأوعية الدموية

Angiogenesis is a vital process for normal tissue development and wound healing, but is also associated with a variety of pathological conditions. Using ...

Analysis of Oxidative Stress in Zebrafish Embryos

High levels of reactive oxygen species (ROS) may cause a change of cellular redox state towards oxidative stress condition. This situation causes oxidation of molecules (lipid, DNA, protein) and leads to cell death. Oxidative stress also impacts the progression of several pathological conditions such as diabetes, retinopathies, neurodegeneration, and cancer. Thus, it is important to define tools to investigate oxidative stress conditions not only at the level of single cells but also in the context of whole organisms. Here, we consider the zebrafish embryo as a useful in vivo system to perform such studies and present a protocol to measure in vivo oxidative stress. Taking advantage of fluorescent ROS probes and zebrafish transgenic fluorescent lines, we develop two different methods to measure oxidative stress in vivo: i) a &#8220;whole embryo ROS-detection method&#8221; for qualitative measurement of oxidative stress and ii) a &#8220;single-cell&#160;ROS detection method&#8221; for quantitative measurements of oxidative stress. Herein, we demonstrate the efficacy of these procedures by increasing oxidative stress in tissues by oxidant agents and physiological or genetic methods. This protocol is amenable for forward genetic screens and it will help address cause-effect relationships of ROS in animal models of oxidative stress-related pathologies such as neurological disorders and cancer.

Here we report a protocol to measure oxidative stress in living zebrafish embryos. This procedure allows reactive oxygen species (ROS) detection in both whole embryo tissues and single-cell populations. This protocol will accomplish both qualitative and quantitative analyses.

تحليل الاكسدة في الزرد الأجنة

High levels of reactive oxygen species (ROS) may cause a change of cellular redox state towards oxidative stress condition. This situation causes ...

Measuring the Osmotic Water Permeability Coefficient (Pf) of Spherical Cells: Isolated Plant Protoplasts as an Example

Studying AQP regulation mechanisms is crucial for the understanding of water relations at both the cellular and the whole plant levels. Presented here is a simple and very efficient method for the determination of the osmotic water permeability coefficient (Pf) in plant protoplasts, applicable in principle also to other spherical cells such as frog oocytes. The first step of the assay is the isolation of protoplasts from the plant tissue of interest by enzymatic digestion into a chamber with an appropriate isotonic solution. The second step consists of an osmotic challenge assay: protoplasts immobilized on the bottom of the chamber are submitted to a constant perfusion starting with an isotonic solution and followed by a hypotonic solution. The cell swelling is video recorded. In the third step, the images are processed offline to yield volume changes, and the time course of the volume changes is correlated with the time course of the change in osmolarity of the chamber perfusion medium, using a curve fitting procedure written in Matlab (the &#8216;PfFit&#8217;), to yield Pf.

Measuring the Osmotic Water Permeability Coefficient Pf of Spherical Cells: Isolated Plant Protoplasts as an Example

Measuring the osmotic water permeability coefficient (Pf) of cells can help understand the regulatory mechanisms of aquaporins (AQPs). Pf determination in spherical plant cell protoplasts presented here involves protoplasts isolation and numerical analysis of their initial rate of volume change as a result of an osmotic challenge during constant bath perfusion.

قياس معامل نفاذية المياه الأسموزي (P<sub&gt; و</sub&gt;) من خلايا كروية: Protoplasts محطة معزولة كمثال

Studying AQP regulation mechanisms is crucial for the understanding of water relations at both the cellular and the whole plant levels. Presented here is ...

Isolation of Murine Valve Endothelial Cells

Normal valve structures consist of stratified layers of specialized extracellular matrix (ECM) interspersed with valve interstitial cells (VICs) and surrounded by a monolayer of valve endothelial cells (VECs). VECs play essential roles in establishing the valve structures during embryonic development, and are important for maintaining life-long valve integrity and function. In contrast to a continuous endothelium over the surface of healthy valve leaflets, VEC disruption is commonly observed in malfunctioning valves and is associated with pathological processes that promote valve disease and dysfunction. Despite the clinical relevance, focused studies determining the contribution of VECs to development and disease processes are limited. The isolation of VECs from animal models would allow for cell-specific experimentation. VECs have been isolated from large animal adult models but due to their small population size, fragileness, and lack of specific markers, no reports of VEC isolations in embryos or adult small animal models have been reported. Here we describe a novel method that allows for the direct isolation of VECs from mice at embryonic and adult stages. Utilizing the Tie2-GFP reporter model that labels all endothelial cells with Green Fluorescent Protein (GFP), we have been successful in isolating GFP-positive (and negative) cells from the semilunar and atrioventricular valve regions using fluorescence activated cell sorting (FACS). Isolated GFP-positive VECs are enriched for endothelial markers, including CD31 and von Willebrand Factor (vWF), and retain endothelial cell expression when cultured; while, GFP-negative cells exhibit molecular profiles and cell shapes consistent with VIC phenotypes. The ability to isolate embryonic and adult murine VECs allows for previously unattainable molecular and functional studies to be carried out on a specific valve cell population, which will greatly improve our understanding of valve development and disease mechanisms.

The ability to isolate heart valve endothelial cells (VECs) is critical for understanding mechanisms of valve development, maintenance, and disease. Here we describe the isolation of VECs from embryonic and adult Tie2-GFP mice using FACS that will allow for studies determining the contribution of VECs in developmental and disease processes.

عزل خلايا الفئران صمام غشائي

Normal valve structures consist of stratified layers of specialized extracellular matrix (ECM) interspersed with valve interstitial cells (VICs) and ...

Quantitation of Endothelial Cell Adhesiveness In Vitro

One of the cardinal processes of inflammation is the infiltration of immune cells from the lumen of the blood vessel to the surrounding tissue. This occurs when endothelial cells, which line blood vessels, become adhesive to circulating immune cells such as monocytes. In vitro measurement of this adhesiveness has until now been done by quantifying the total number of monocytes that adhere to an endothelial layer either as a direct count or by indirect measurement of the fluorescence of adherent monocytes. While such measurements do indicate the average adhesiveness of the endothelial cell population, they are confounded by a number of factors, such as cell number, and do not reveal the proportion of endothelial cells that are actually adhesive. Here we describe and demonstrate a method which allows the enumeration of adhesive cells within a tested population of endothelial monolayer. Endothelial cells are grown on glass coverslips and following desired treatment are challenged with monocytes (that may be fluorescently labeled). After incubation, a rinsing procedure, involving multiple rounds of immersion and draining, the cells are fixed. Adhesive endothelial cells, which are surrounded by monocytes are readily identified and enumerated, giving an adhesion index that reveals the actual proportion of endothelial cells within the population that are adhesive.

Quantitation of Endothelial Cell Adhesiveness In Vitro

We report an in vitro method that allows the quantitation of the actual number of adhesive cells within an endothelial cell monolayer.

الكميات من البطانية الإلتصاق الخليوي<em&gt; في المختبر</em

One of the cardinal processes of inflammation is the infiltration of immune cells from the lumen of the blood vessel to the surrounding tissue. This ...

Isolation and Primary Culture of Mouse Aortic Endothelial Cells

The vascular endothelium is essential to normal vascular homeostasis. Its dysfunction participates in various cardiovascular disorders. The mouse is an important model for cardiovascular disease research. This study demonstrates a simple method to isolate and culture endothelial cells from the mouse aorta without any special equipment. To isolate endothelial cells, the thoracic aorta is quickly removed from the mouse body, and the attached adipose tissue and connective tissue are removed from the aorta. The aorta is cut into 1 mm rings. Each aortic ring is opened and seeded onto a growth factor reduced matrix with the endothelium facing down. The segments are cultured in endothelial cell growth medium for about 4 days. The endothelial sprouting starts as early as day 2. The segments are then removed and the cells are cultured continually until they reach confluence. The endothelial cells are harvested using neutral proteinase and cultured in endothelial cell growth medium for another two passages before being used for experiments. Immunofluorescence staining indicated that after the second passage the majority of cells were double positive for Dil-ac-LDL uptake, Lectin binding, and CD31 staining, the typical characteristics of endothelial cells. It is suggested that cells at the second to third passages are suitable for in vitro and in vivo experiments to study the endothelial biology. Our protocol provides an effective means of identifying specific cellular and molecular mechanisms in endothelial cell physiopathology.

The vascular endothelial cells play a significant role in many important cardiovascular disorders. This article describes a simple method to isolate and expand endothelial cells from the mouse aorta without using any special equipment. Our protocol provides an effective means of identifying mechanisms in endothelial cell physiopathology.

العزلة والثقافة الابتدائية من خلايا الفأر الأورطي غشائي

The vascular endothelium is essential to normal vascular homeostasis. Its dysfunction participates in various cardiovascular disorders. The mouse is an ...