Research reported in this publication was supported by the National Institute of Allergy and Infectious Diseases (NIAID) of the NIH under award number R01AI114362 and Welch Foundation grant I-1782 to Iv&#225;n D'Orso.

1. 도금 세포 <ol><li> 전날 형질에 10 % (v / v)의 소 태아 혈청 (FBS), 1 % (v / v)의 페니실린 / 스트렙토 마이신이 보충 된 둘 베코 변형 이글 중간 (DMEM) 10 mL에 3.5 × 106 HEK293T 세포 플레이트 100mm 접시 당 (10,000 U / ㎖의 주). 플레이트 (3) - 실험 / 상태 당 5 100mm 요리는 충분한 단백질 복구를 보장합니다. 주 : 판의 개수는 관심있는 단백질 복합체의 발현 수준과 용해도에 의존하는 각 실험 / 조건에 대해 결정되어야한다. 대규모의 정제가 필요한 경우에는 세포주 스피너 플라스크이 현탁액에서 성장하도록 적응 될 수 있지만,이 방법은 일시적 형질 감염을 위해 작동하지 않을 것이다. </li></ol> 2. 안정 세포주를 세포 형질 감염 또는 유도 <ol><li> 다음 날, 현미경으로 세포를 확인합니다. proce을하기 전에 80 % 합류 - 세포는 70해야합니다대한 수정 사항. </li><li> 100mm의 접시 당 형질 감염 시약 7 플라스미드 DNA의 μg의 21 μl의 총 혼합물로 세포를 형질 감염. 형질 감염 효율에 대한 제어는 벡터 표현 GFP (표 1)과 함께 형질 감염 세포. 주 : 독시사이클린 14, 15에 대응하여 두 개 이상의 복잡한 소단위의 발현을 유도 HEK293-T-REX 또는 유사한 안정한 세포주를 사용하는 경우, 유도제는 세포에 첨가하고 48 시간 동안 배양되어야 할 것이다. 마찬가지로, 유도제의 첨가에 따라 GFP의 발현을 유도하는 안정한 세포 라인은 또한 검증을 위해 요구된다. 2.7 단계로 진행합니다. </li><li> 100mm 접시 당 형질 전환 혼합물을 준비합니다. 1.5 ml의 마이크로 원심 튜브 (둘 이상의 플라스미드에 상당)의 총 플라스미드 DNA 7 μg의로 비추 DMEM 500 μL를 혼합한다. 별도의 microcentrifuge 관에서 비추 DMEM 위스콘신의 500 μl를 혼합트랜 시약의 제 21 μL. 각 형질 전환 반응에 대해 반복합니다. </li><li> 플라스미드 DNA 용액으로 형질 감염 시약 용액을 피펫 (역순으로 용액을 혼합하지 않음). 적어도 4 회 피펫 팅하여 혼합한다. </li><li> 10 시간 동안 실온에서 혼합물을 부화하지 - 15 분, 그러나 더 이상 15 분 이상. </li><li> 미디어 저장소를 생성하고 조심스럽게 세포를 방해하지 않고 판의 내부면에 드롭 현명 형질 전환 혼합물을 피펫 할 수있는 판을 기울입니다. 원래 평평한 위치에 접시를 반환하고, 혼합물을 배포하는 부드럽게 소용돌이 친다. </li><li> (이 조건은 이하 &quot;조직 배양 인큐베이터&quot;라 함), 5 % CO 2 습윤 세포 배양 인큐베이터에서 37 ℃에서 세포를 인큐베이션. 미디어 5 시간 후 형질 전환 (옵션) 장착합니다. </li></ol> 3. 검사의 형질 또는 유도 효율 <ol><li> 24 시간 후 형질에서, 독감에서 세포를 시각화orescent 현미경은 형질 전환 효율 (또는 GFP를 발현 제어 HEK293T 렉스 안정적인 세포주의 유도)를 확인합니다. 또 다른 24 시간 동안 품어. </li></ol> 4. STREP 선호도 정화 (STREP AP) <ol><li> 세포를 수집 <ol><li> 48 시간 포스트 형질에서 미디어를 제거하고 차가운 1X 인산 완충 식염수 (PBS)의 8 ml를 추가합니다. 접시에서 세포를 분리 아래로 피펫합니다. </li><li> 수집하고, 15 ㎖의 튜브에 세포 현탁액을 전송하고 4 ℃에서 4 분 동안 800 XG에서 세포를 스핀 다운. </li><li> PBS를 상층 액을 제거합니다. 잔여 PBS를 제거하기 (4 ℃에서 1 분 동안 800 XG)를 스핀을 반복합니다. 나중에 사용하기 위해 -80 ° C에서 세포 펠렛을 저장 또는 단백질 정제를 계속하려면 다음 절차를 따르십시오. </li></ol></li><li> 세포를 용균 <ol><li> 패시브 용해 완충액을 세포 펠렛 부피 × 5를 사용하여 세포 펠릿 (~ 플레이트 당 250 μL)에 재현 탁(PLB : 20 mM의 pH 7.5 인 Tris-HCl, 150 mM의 염화나트륨, 1.5 밀리미터의 MgCl 2, 1 mM의 DTT, 프로테아제 억제제 칵테일 정제, 5 % V / V 글리세롤, 1.0 % NP-40) 및에 세포 현탁액을 전송 1.5 ml의 microcentrifuge 관. </li><li> 간단히 4 ° C에서 30 분 동안 정지 및 nutate을 소용돌이. </li><li> 4 ° C에서 10 분 동안 10,000 XG에서 세포 현탁액을 스핀. </li><li> 새로운 1.5 ML의 microcentrifuge 관에 용해 용 해물을 전송하고 세포 펠렛을 폐기합니다. 같은 수용성 해물의 최종 부피의 10 % 할인 &quot;연쇄상 구균 AP 입력.&quot; 4 ℃에서 보관하십시오. </li></ol></li><li> 연쇄상 구균 구슬을 평형화 참고 : 첫 번째 AP 단계에 대한 사용 STREP 구슬! 연쇄상 구균 구슬 FLAG 구슬 아래로 끌어 것보다 훨씬 더 많은 단백질을 복구와 단지 아래로 당겼다. <ol><li> 꺼내 (n은 40 μl를 ×) + n은 50 % 연쇄상 구균 비드 슬러리의 μL (N = 샘플 수), 4 ℃에서 2 분 동안 1,500 XG에 스핀 다운. 참고 : 넓은 m를 사용하여피펫 구슬에 outhed 팁. </li><li> 상층 액을 제거하고 구슬에 PLB의 500 μl를 추가합니다. 4 ℃에서 5 분 동안 구슬 혼합물을 Nutate. 4 ° C에서 2 분 동안 1,500 XG에 스핀 다운. <ol><li> 3 세척 총 반복합니다. 40 μL × N의 최종 부피로 PLB의 비드를 재현 탁. </li></ol></li><li> 4 ° C에서 2 시간 동안 각각의 세포 용 해물 샘플 및 nutate 50 % 연쇄상 구균 비드 슬러리의 40 μl를 추가합니다. </li></ol></li><li> STREP AP <ol><li> 4 ℃에서 2 분 동안 1,500 XG에서 솔루션을 스핀 다운. </li><li> 4 ° C에서 &quot;STREP AP 플로우를 통해 (FT)&quot;로 뜨는 및 저장소를 제거합니다. </li><li> I (20 mM 트리스 - 염산의 pH 7.5, 250 mM의 염화나트륨, 1.5 밀리미터의 MgCl 2, 1 mM의 DTT, 5 % 글리세롤 및 0.2 % NP-40) STREP AP 세척 버퍼 구슬에 500 μl를 추가합니다. 4 ℃에서 2 분 동안 1,500 XG에서 5 4 ° C에서 분 원심 분리기의 구슬 혼합물을 Nutate. 상층 액을 버린다. <ol><li> 네 세척의 총 반복합니다. <br/&gt; 주 : 네번째 세척 전에 단백질 배경을 감소시키는 새로운 1.5 ML의 마이크로 원심 튜브에 비드 용액 옮긴다. 이 단계는 필수적이다. </li></ol></li><li> 500 μL 세척 버퍼 II (100 mM 트리스 - 염산의 pH 8.0, 150 mM의 염화나트륨, 1 mM의 EDTA)를 추가하고 튜브를 반전 구슬을 평형. 4 ° C에서 2 분 동안 1,500 XG에 스핀 다운 및 상층 액을 버린다. </li><li> STREP 용출 버퍼 (100 mM 트리스 - 염산의 pH 8.0, 150 mM의 염화나트륨, 1 mM의 EDTA, 2.5 mM의 Desthiobiotin)의 50 μL과 관심의 단백질을 용출. 4 ℃에서 15 분 동안 800 rpm에서 소용돌이. </li><li> 4 ° C에서 1 분 동안 1,500 XG에서 구슬을 스핀 다운. 상층 액을 수집합니다. 이 부분은 &quot;STREP AP 용출&quot;샘플에 해당합니다. </li><li> 제 1 용출 얻어진 단백질의 양의 절반까지 얻을 수있는 초 용출, 4 ° C에서의 비드 부분을 저장한다. 실버 염색 및 / 또는 웨스턴 블로 팅에 대한 STREP AP 용출의 나누어지는 10 %16. </li></ol></li><li> 국기 구슬을 평형화 <ol><li> (NX 16 μL) + n은 FLAG 비즈 솔루션의 μL (샘플 N = 번호)를 꺼내 4 ℃에서 2 분 동안 1,500 XG에 스핀 다운. 참고 : 피펫 구슬에 입이 큰 팁을 사용합니다. </li><li> 상층 액을 제거하고 FLAG 세척 버퍼 500 μL를 추가 (100 mM 트리스 - 염산의 pH 8.0, 150 mM의 염화나트륨, 1 mM의 EDTA, 0.1 % NP-40) 구슬에. 4 ° C에서 2 분 동안 1,500 XG에 스핀 다운. 3 세척 총 반복합니다. </li><li> NX 16 μL의 최종 부피 FLAG 세척 완충액으로 비드를 재현 탁. </li><li> 4 ° C에서 나머지 STREP AP 용출 및 nutate 하룻밤에 FLAG 비드 슬러리의 16 μl를 추가합니다. </li></ol></li></ol> 5. FLAG IP <ol><li> 4 ° C에서 2 분 동안 1,500 XG에서 플래그 구슬 서스펜션을 스핀. 4 ° C에서 &quot;FLAG IP 플로우를 통해&quot;(FT)으로 뜨는 및 저장소를 저장합니다. </li><li> 500 추가(81); 솔루션에 FLAG 세척 버퍼의 리터. 4 ° C에서 2 분 동안 1,500 XG에 5 4 ° C에서 분 원심 분리기에 대한 Nutate. 네 세척의 총 반복하고 각 세척 한 후 상층 액을 제거합니다. 주 : 네번째 세척 전에 배경을 감소시키는 새로운 1.5 ㎖의 마이크로 원심 튜브에 단백질로 비드 용액 옮긴다. 이 단계는 필수적이다. </li><li> 마지막 스핀에서 뜨는을 제거하고 구슬로 FLAG 펩타이드의 200 NG / μl를 포함 FLAG 세척 버퍼의 30 μL를 추가합니다. 4 ℃에서 2 시간 동안 800 rpm에서 소용돌이. </li><li> 4 ° C에서 2 분 동안 1,500 XG에서 정지를 스핀 다운. 으로 4 ° C에서 뜨는 및 저장소를 수확 &quot;FLAG IP 용출.&quot; 참고 : 용출 샘플 표준 프로토콜 16을 사용하여 실버 얼룩 및 / 또는 웨스턴 블롯으로 확인하고, 또한 단백질 분석을위한 준비가 될 수있다. (1) STREP AP 입력, (2) STREP AP FT, (3) STREP AP Eluti : 웨스턴 블롯을 설정할 때, 다음의 모든 샘플을 실행(4) FLAG IP FT, (5) FLAG IP 용출에. 로드 볼륨은 각 실험에 대해 결정되어야 할 것이다. 수집 된 모든 샘플과 비드 단기 기억과 장기 보존 -80 ° C에서 39 ° C에서 저장 될 수있다. TAP 샘플들은, 그 구성 요소의 신원을 확인하는 신규 번역 후 변형 (PTMS)를 식별 및 / 또는 정제 착체 2 (17)와 임의의 신규 단백질 상호 작용을 발견 질량 분석법에 의해 분석 될 수있다. 이러한 목적하는 쿠마 겔 또는은 염색을 실행 한 후, 밴드 깨끗한 메스를 사용하여 겔로부터 절제 될 수있다. 질량 분석 방법을 논의 몇 가지 우수한 리뷰 이전에, 19 (18)을 발표했다. </li></ol>

<ol>
	<li>Sharan, R., Ulitsky, I., Shamir, R. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Network-based+prediction+of+protein+function.">Network-based prediction of protein function.</a> Mol Syst Biol. 3, 88-99 (2007).</li><li>Jager, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Global+landscape+of+HIV-human+protein+complexes.">Global landscape of HIV-human protein complexes.</a> Nature. 481, 365-370 (2012).</li><li>Fields, S., Song, O. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+novel+genetic+system+to+detect+protein-protein+interactions.">A novel genetic system to detect protein-protein interactions.</a> Nature. 340, 245-246 (1989).</li><li>Luo, Y., Batalao, A., Zhou, H., Zhu, L. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Mammalian+two-hybrid+system:+a+complementary+approach+to+the+yeast+two-hybrid+system.">Mammalian two-hybrid system: a complementary approach to the yeast two-hybrid system.</a> Biotechniques. 22, 350-352 (1997).</li><li>Lee, C. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Coimmunoprecipitation+assay.">Coimmunoprecipitation assay.</a> Methods Mol Biol. 362, 401-406 (2007).</li><li>Puig, O., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+tandem+affinity+purification+(TAP)+method:+a+general+procedure+of+protein+complex+purification.">The tandem affinity purification (TAP) method: a general procedure of protein complex purification.</a> Methods. 24, 218-229 (2001).</li><li>Jager, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Purification+and+characterization+of+HIV-human+protein+complexes.">Purification and characterization of HIV-human protein complexes.</a> Methods. 53, 13-19 (2011).</li><li>Price, D. H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=P-TEFb,+a+cyclin-dependent+kinase+controlling+elongation+by+RNA+polymerase+II.">P-TEFb, a cyclin-dependent kinase controlling elongation by RNA polymerase II.</a> Mol Cell Biol. 20, 2629-2634 (2000).</li><li>Peterlin, B. M., Price, D. H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Controlling+the+elongation+phase+of+transcription+with+P-TEFb.">Controlling the elongation phase of transcription with P-TEFb.</a> Mol Cell. 23, 297-305 (2006).</li><li>McNamara, R. P., McCann, J. L., Gudipaty, S. A., D'Orso, I. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Transcription+factors+mediate+the+enzymatic+disassembly+of+promoter-bound+7SK+snRNP+to+locally+recruit+P-TEFb+for+transcription+elongation.">Transcription factors mediate the enzymatic disassembly of promoter-bound 7SK snRNP to locally recruit P-TEFb for transcription elongation.</a> Cell Rep. 5, 1256-1268 (2013).</li><li>Adelman, K., Lis, J. T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Promoter-proximal+pausing+of+RNA+polymerase+II:+emerging+roles+in+metazoans.">Promoter-proximal pausing of RNA polymerase II: emerging roles in metazoans.</a> Nat Rev Genet. 13, 720-731 (2012).</li><li>D'Orso, I. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=7SKiing+on+chromatin:+move+globally,+act+locally.">7SKiing on chromatin: move globally, act locally.</a> RNA Biol. 13, 545-553 (2016).</li><li>McNamara, R. P., Bacon, C. W., D'Orso, I. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Transcription+Elongation+Control+by+the+7SK+snRNP+Complex:+Releasing+the+Pause.">Transcription Elongation Control by the 7SK snRNP Complex: Releasing the Pause.</a> Cell Cycle. 15, 2115-2123 (2016).</li><li>Yao, F., Svensjo, T., Winkler, T., Lu, M., Eriksson, C., Eriksson, E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Tetracycline+repressor,+tetR,+rather+than+the+tetR-mammalian+cell+transcription+factor+fusion+derivatives,+regulates+inducible+gene+expression+in+mammalian+cells.">Tetracycline repressor, tetR, rather than the tetR-mammalian cell transcription factor fusion derivatives, regulates inducible gene expression in mammalian cells.</a> Hum Gene Ther. 9, 1939-1950 (1998).</li><li>McNamara, R. P., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=KAP1+Recruitment+of+the+7SK+snRNP+Complex+to+Promoters+Enables+Transcription+Elongation+by+RNA+Polymerase+II.">KAP1 Recruitment of the 7SK snRNP Complex to Promoters Enables Transcription Elongation by RNA Polymerase II.</a> Mol Cell. 61, 39-53 (2016).</li><li>Ausubel, F. M., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=.">.</a> Current Protocols in Molecular Biology. , (1994).</li><li>Trudgian, D. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Comparative+evaluation+of+label-free+SINQ+normalized+spectral+index+quantitation+in+the+central+proteomics+facilities+pipeline.">Comparative evaluation of label-free SINQ normalized spectral index quantitation in the central proteomics facilities pipeline.</a> Proteomics. 11, 2790-2797 (2011).</li><li>Choudhary, C., Mann, M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Decoding+signalling+networks+by+mass+spectrometry-based+proteomics.">Decoding signalling networks by mass spectrometry-based proteomics.</a> Nat Rev Mol Cell Biol. 11, 427-439 (2010).</li><li>Bensimon, A., Heck, A. J., Aebersold, R. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Mass+spectrometry-based+proteomics+and+network+biology.">Mass spectrometry-based proteomics and network biology.</a> Annu Rev Biochem. 81, 379-405 (2012).</li><li>Rogers, S., Wells, R., Rechsteiner, M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Amino+acid+sequences+common+to+rapidly+degraded+proteins:+the+PEST+hypothesis.">Amino acid sequences common to rapidly degraded proteins: the PEST hypothesis.</a> Science. 234, 364-368 (1986).</li></ol>

The authors have nothing to disclose.

발현 및 진핵 세포에서 단백질 복합체의 분리를 위해 여기에 설명 된 프로토콜은 분자 어셈블리의 생화학 적 특성에 한정되지 않고, 그 기능을 조절할 수있는 신규 인터랙 번역 후 변형의 식별에 이용 될 수있다. 친 화성 태그의 활용은이 프로토콜에서 언급 한 내용에 제한되지 않는다; 그러나 우리의 경험은 제 AP 단계로 STREP을 사용하여 상당히 최종 단백질 - 단백질 복합체의 수율을 향상하는 것이 제안한다. 모두와 연쇄상 구균 구슬에서 바인딩 및 용출 단계 (예를 들면, FLAG) 다른 에피토프 태그에 비해 매우 효율적입니다. 또한, 이론적으로, TAP는 버퍼 조건 (모두 과도 안정적인 발현 시스템) 실험 당 접시 수 등뿐만 아니라 약간의 최적화와 다른 단백질 또는 도메인에 적용될 수는 TAP 방법도있을 수있다 응용 t다른 세포주 O를 특정 단백질 복합체는 그 기능 또는 고유 요인과의 상호 작용을위한 특별한 시스템이 필요합니다. 문제 해결을 용이하게하기 위해, 매우 입력 및 FT 샘플 모두 (표 2)에 저장하는 것이 좋습니다. 예상 된 단백질 밴드를 용출 시각화 할 수없는 경우, FT 샘플을 실험을 해결하고 샘플을 결합 및 / 또는 비드 오프 용출했는지 여부를 판정하는데 사용될 수있다. 성공적인 TAP는 단백질 발현 및 복구의 높은 수준에 엄격하게 의존한다. 따라서, 연구자들은 경우에 따라 출발 물질의 양을 최적화 할 것이다. 일시적 형질 감염은 단백질 성분을 표현하기 위해 사용되는 경우, 형질 전환 효율은 TAP의 두 번째 단계를 진행하기 전에 적어도 70 %이어야한다. (에피토프 두 베이트간에 교환 된) 왕복 TAP 방식은 통상적으로 한 실험 전략을 결정하는데 도움최고의 순도와 수율을 달성하는 데 사용되어야한다. 또,이 경우에 따라 조사해야 할 것이다. 중요한 것은, 상호 TAP을 수행하는 것은 또한 PPI 사용 친 화성 태그의 독립적 인 확인합니다. 제시된 TAP 방법의 일부 측면은 여기에 제한이 있습니다. 예를 들어, 플래그 - 및 STREP - 태그 단백질을 과발현은 ectopically 발현 된 단백질 자체 또는 인터랙에 대한 아티팩트를 생성 할 수있다. 상이한 에피토프 태그 단백질 발현, 단백질의 입체 구조, 및 / 또는 세포 내 위치 파악에 영향을 미칠 수있다. 세포주 및 트랜 스펙 션 효율을 제한 외에, 착체의 크기가 문제가 될 수있는 정제한다. 이것은 TAP 방식은 다중 - 서브 유니트 단백질 복합체에 대해 잘 작동한다. 우리의 경험에서, 네 개의 구성 요소를 실버 염색으로 검출 할 수있다 (데이터는 보이지 않음). 이 태그가 구성 요소를 사용하는 경우에는, 다른 인터랙 공동 정제 동일한 화학 양 론적 수준에서되지 않을 수 있습니다. 따라서,특정 목표를 위해, 복잡한 구성 요소의 발현 수준이 낮은 유도 세포주의 사용이 권장된다. 또 다른 한계는 PPI의 힘이 될 것이다. 상호 작용이 충분히 안정하지 않는 경우, 어떤 성분이 (특히, 마지막에 IP FLAG 단계에서) 정제 단계 동안 손실 될 수있다. 탭 방법은 전술 한 몇 가지 에피토프 태그, 테스트 검증 및 6을 비교 하였다. 그러나이 문서에 나와있는 TAP 방법은 소설과 프로톤 펌프 억제제, 복잡한 어셈블리를 공부하고, 단백질 네트워크 구성과 기능을 추론 할 수있는, 쉽고 효율적으로, 강력한 대체 전략을 제공합니다. 이전 TAP 방법과 비교하여,이 STREP-FLAG의 TAP 전략은 복잡한 구성, 활동, 또는 함수의 사전 지식없이 더 특성화 단지의 급속한 정제 할 수 있습니다; 단백질 용출 프로테아제 절단 (예, TEV)의 필요없이 (WH무형 문화 유산은 크게) 단백질 수율을 감소시킬 수있다. 때문에 증가 된 단백질 복합체 복구 중, STREP-FLAG의 TAP 방법은 탠덤 질량 분석 분석 (10), (15)을 통해 세포에 대한 관심의 단백질 복합체과 연관 단백질의 강력한 식별 할 수 있습니다. 이어서, 다른 방법은, 공 초점 현미경, 크기 배제 크로마토 그래피, 및 CO-IP 분석처럼 또한 프로톤 펌프 억제제를 확인하기 위해 이용 될 수있다. 마지막으로, 우리는 TAP 프로토콜의 다른 버전은 정화 대단히 RNA 생물학 분야 연구를 도울 것이다 이산 단백질 RNA 복합체의 조립체를 연구하기에 적합 할 수 있다고 제안한다. 요약하면, 우리는 정화 포유류 세포주에서 프로톤 펌프 억제제를 특성화하는 방법을 제시한다. 우리는이 방법은 미래의 특성화 및 많은 새로운 단백질 복합체의 기능 분석을위한 토대를 마련 것을 제안한다.

<html> 단백질 - 단백질 상호 작용 (프로톤 펌프 억제제)는 그 기능이에 대해 알릴 수 생물학적 과정 (1),이 프로톤 펌프 억제제에 대한 추가 연구의 정확한 조절을 위해 중요하다. 몇몇 접근법은 프로톤 펌프 억제제의 연구 및 특성뿐만 아니라 신규 조절 단백질 성분의 드 노보 식별을 위해 고안되었다. 1989 년 스탠리 필드와 동료들은 효모 두 하이브리드 (Y2H) 분석 (3) 보도했다. 이 방법은 사카로 마이 세스 세레 비지에 인터랙 관심 (미끼)의 정의 단백질 (할까요)의 공평하고 포괄적 인 식별 할 수 있습니다. 프로톤 펌프 억제제를 발견하기위한 현저한 유틸리티 또한 Y2H 분석은, 효모 세포에서 단백질을 특성화 쌍 최소 상호 작용 도메인을 정의하고, 이러한 상호 작용을 폐지 변이를 식별하는데 사용될 수있다. Y2H 분석을 수정하여, 프로톤 펌프 억제제는 포유 동물 세포에서 공부하실 수 있습니다클래스 = &quot;외부 참조&quot;&gt; 4. Y2H 분석 (예, 효모 세 하이브리드 시스템)의 변형, 단백질 및 RNA 세포 단백질 작은 유기 리간드 상호 작용을 연구에 적용 할 수있다. 상동 시스템에서 프로톤 펌프 억제제를 연구하는 또 다른 일반적으로 사용되는 도구는 공동 면역 (공동 IP) 분석 5입니다. 관심의 단백질을 면역 침전에 대한 항체를 사용하여, 공동 IP 분석 연구자들은 다양한 환경 조건 및 실험 상황에서 셀의 프로톤 펌프 억제제를 모니터링 할 수있다. 에피토프 - 태그 단백질 (예를 들면, FLAG는, Myc와, STREP 및 HA는, 다른 사람의 사이에서) 친 화성 정화 (AP) 방법이 서양 얼룩 등 여러 다운 스트림 분석 복잡한 단백질 혼합물에서 단백질의 분리를 촉진했다,은 얼룩의 사용 및 효소 분석. 그러나 이러한 이전 방법 중 어느 것도 체외을 포함하여 더 특성화 단백질 복합체의 대량의 분리를 사용하지ssays, 질량 분석 및 번역 후 변형의 식별에 의한 규제 서브 유닛의 발견. AP 통신 방식의 향상된 버전은 두 개의 연속적인 AP들 (6, 7)를 통해 정제하여 두 에피토프와 융합 단백질을 생성하여 프로톤 펌프 억제제의 연구를위한 정제 기술이다 텐덤 AP (TAP)를 호출한다. 이 문서에서 우리는 두 개의 서브 유닛이 다른 에피토프 태그 다음 두 순차 액세스 포인트 (AP STREP FLAG IP 다음)를 통해 정제하는 정제 단백질 복합체의 TAP 방법의 변화를 제시한다. 연구자들이 관심을 자신의 단백질 복합체에 적용 할 수 있도록 우리가 먼저, TAP의 최소한의 개요 (그림 1)과 모든 실험 단계에 대한 자세한 설명 (그림 2)을 제공한다. 탭 방식의 적용 성을 입증하기 위해, 우리는 (복소 잘 특징 사이클린 CDK는 PT라고 선택한규제 소단위 사이클린 T1 (CycT1) 및 키나제 (경우, Cdk9)로 구성되며, RNA 중합 효소 II (POL II) 8, 9, 10에 의해 전사 조절에 관여 EFB 키나아제). P-TEFb는 폴 II 상기 프로모터에서 전사를 일시 완화 연관된 부정적인 신장 요소의 C 말단 도메인을 인산화시켜 전사 신도 11, 12, 13을 용이하게한다. 이를 염두에 알려진 상호 작용, CycT1을 STREP - 태그 및 FLAG-태그 경우, Cdk9는 HEK293T 세포에서 발현 이상이었다. 상호 TAP 실험은 더 단백질 상호 작용이 사용 된 에피토프에 독립적 인 것을 확인하는 STREP-태그 경우, Cdk9과 FLAG-태그 CycT1로 하였다. 세포를 수거하고, 48 시간 후 형질 감염을 용해시켰다. 가용성 해물이 TAP 그래피 (STREP AP는 FLAG 다음IP). 입력 및 정제 된 단백질은 서양 얼룩과 실버 얼룩 (그림 3)에 의해 분석 하였다.

<table border="1" fo:keep-together.within-page="1" fo:keep-with-next.within-page="always">
	<tbody>
		<tr>
			<td>Dulbecco&#39;s Modified Eagle Medium (DMEM)</td>
			<td>Fisher Scientific</td>
			<td>SH30022FS</td>
			<td></td>
		</tr>
		<tr>
			<td>Fetal bovine serum</td>
			<td>Hyclone</td>
			<td>SH30071</td>
			<td></td>
		</tr>
		<tr>
			<td>Penicillin/Streptomycin</td>
			<td>Fisher Scientific</td>
			<td>MP091670049</td>
			<td></td>
		</tr>
		<tr>
			<td>PolyJet</td>
			<td>Fisher Scientific</td>
			<td>50-478-8</td>
			<td></td>
		</tr>
		<tr>
			<td>Protease inhibitor cocktail&#160;</td>
			<td>Roche&#160;</td>
			<td>11836153001</td>
			<td></td>
		</tr>
		<tr>
			<td>STREP-Tactin Superflow</td>
			<td>IBA</td>
			<td>2-1208-010</td>
			<td></td>
		</tr>
		<tr>
			<td>STREP-tag elution buffer</td>
			<td>IBA</td>
			<td>2-1000-025</td>
			<td></td>
		</tr>
		<tr>
			<td>EZview Red ANTI-FLAG M2 Affinity Gel</td>
			<td>Sigma</td>
			<td>SLBQ1981V</td>
			<td></td>
		</tr>
		<tr>
			<td>Corning 100mm &#215; 20 mm style Dish cell culture treated nonpyrogenic polystyrene 20/sleeve</td>
			<td>Corning&#160;</td>
			<td>430167</td>
			<td></td>
		</tr>
		<tr>
			<td>Protein Lo-Bind Eppendorf</td>
			<td>Fisher Scientific</td>
			<td>13-698-794</td>
			<td></td>
		</tr>
		<tr>
			<td>Digital Vortex Mixer</td>
			<td>Fisher Scientific&#160;</td>
			<td>02-215-370</td>
			<td></td>
		</tr>
		<tr>
			<td>48 hole micro tube foam rack</td>
			<td>Fisher Scientific</td>
			<td>02-215-386</td>
			<td></td>
		</tr>
		<tr>
			<td>Labquake shaker rotisserie&#160;</td>
			<td>Thermo&#160;</td>
			<td>415110</td>
			<td></td>
		</tr>
	</tbody>
</table>

tandem affinity purification of protein complexes from eukaryotic cells

활성 단백질 - 단백질, 단백질 - 핵산 복합체의 정제 효소 활성 및 신규 서브 유닛 및 번역 후 변형의 드 노보 식별의 특성에 매우 중요하다. 박테리아 시스템들은 단일 폴리펩티드 및 단백질 복합체의 다양한 발현 및 정제를 허용한다. 그러나,이 시스템은 번역 후 변형 (예를 들어, 아세틸 화 및 포스 포 릴화)을 포함 소단위 단백질의 정제 및 진핵 시스템에서의 발현 만 존재하는 신규 규제 소단위 /의 식별을 가능하게하지 않는다. 여기서 우리는 진핵 세포에서 일시적으로 또는 안정적으로 표현 에피토프 - 태그 단백질과 단백질 복합체의 정제를 용이하게하는 소설, 강력한, 그리고 STREP-를 사용하여 효율적인 탠덤 선호도 정화 (TAP) 방식과 FLAG-태그 단백질에 대한 자세한 설명을 제공합니다. 이 프로토콜은 PROT의 특성을 적용 할 수있다EIN 복잡한 기능 복잡한 서브 유닛의 번역 후 변형을 발견, 및 질량 분광법에 의해 신규 규제 복잡한 구성 요소를 식별하기. 특히,이 방법은 TAP 따라서 하류 실험 기회 광범위한 항복 진핵 또는 병원성 (바이러스 성 및 세균성) 구성 요소에 의해 형성되는 단백질 복합체를 연구에 적용될 수있다. 우리는 단백질 복합체와 협력 연구자들이 다양한 방법으로이 방법을 활용할 수 있다고 제안한다.

이 글에서, 우리는 (또한 P-TEFb 키나제라고도 함) 복잡한 잘 특징 CycT1-경우, Cdk9에 TAP 방법의 적용 가능성을 보여줍니다. 그리고 경우, Cdk9-FLAG (경우, Cdk9 : F), 또는 경우, Cdk9-STREP (경우, Cdk9 : S) 및 시클 T1-FLAG (CycT1 : F) : 시클 T1-STREP (S CycT1) 인코딩하는 플라스미드 (표 1), HEK293T 세포로 형질 감염시켰다 . F 또는 CycT1 : (각각도 3a 및 B) F 플라스미드 음성 대조군은 빈 벡터와 경우, Cdk9와 형질을 포함했다. 세포를 수거하기 전에 단백질은 48 시간 동안 발현되었다. 세포의 여러 접시는 단백질 생산 및 복구를 증가 (샘플에 5 판 그림 3에 제시된 데이터를 사용했다) 실험을 당 하였다. 세포가 개별 마이크로 원심 튜브에 용해시킨 후, 동일한 시료의 세포 용 해물 하나 microcentrif로 합하고연쇄상 구균 구슬을 추가하기 전에 UGE 튜브. 비드의 일부와 단백질 샘플을 결합하여 표현하기 어려운 단백질의 단백질 복구를 개선 할 수있는 최종 단백질 농도를 증가시킨다. 초기 용출에 이어, 제 용출 플래그 IP에 대한 총 단백질 입력을 증가시키기 위해 수행 될 수있다. 또한 필요한 경우, 나중에 문제 (표 2)에 비즈를 첨가하기 전에 각각의 정제 단계의 입력을 저장하는 것이 중요하다. S와 경우, Cdk9 : F, 웨스턴 블롯 분석도 3a의 데이터는 CycT1의 TAP 방법의 결과를 보여줍니다. 경우, Cdk9 : F의 CycT1와 공동는-용출 : S를 연쇄상 구균 구슬에서,하지만 CycT1 부족한 음성 대조군 AP에서 : S를, 그 경우, Cdk9를 나타내는 : F와 CycT1는 : S는 단백질 - 단백질 복합체를 형성한다. 예상대로, 두 단백질은 상기 복합체 형성 확인 플래그 용출에서 검출되었다. 도 3b는 resu를 도시(: S 및 CycT1 : 경우, Cdk9 F) 상호 TAP의 두 단백질의 에피토프 태그가 교체 된 방법의 LTS 및 웨스턴 블롯 분석. 도 3C 및 3D는 각각 실버 염색으로 분석 TAP과 상호 TAP의 결과를 보여줍니다. F CycT1와 공동 용리 : S를 STREP 구슬 떨어져 있지만 제어 AP (레인 1)에서, 이와 같이 경우, Cdk9 나타내는 : F 및 CycT1은 : S는 단백질 - 단백질 복합체를 형성도 3c 레인 2는 경우, Cdk9는 것을 보여 주었다. 후속 FLAG 용출에서는로서 레인 4에 도시 CycT1은 다음 FLAG 비드 오프 F : S의 경우, Cdk9와 공동 용출시켰다. STREP 비드 오프 S를하지만, 단백질 - 단백질 복합체를 효율적으로 제 2 플래그의 IP 단계 이후에 회수되지 제어 AP에서, 그것은 : F의 경우, Cdk9와 공동 용리 : 유사하게,도 3D는 CycT1 것으로 나타났다. 모두 서쪽 오 점 및 실버 얼룩은 TAP 프로토콜은 purificatio 효율적으로 일 확인<html> N, 격리 및 관심있는 단백질 복합체의 특성. <img alt="그림 1" src="/files/ftp_upload/55236/55236fig1.jpg" /> 그림 1 : TAP 정화 전략의 개요. TAP의 단계를 설명하는 간단한 방식. 어느 STREP 또는 FLAG 에피토프 태그 관심의 단백질을 코딩하는 플라스미드 공동 형질 전환 된 포유 동물 세포에 있습니다. 48 시간 유도 후에, 세포를 수거하고, 용해된다. 다른 단백질과 함께 관심의 단백질을 함유하고있는 수용성 세포 용 해물은 STREP AP에 대한 연쇄상 구균 구슬에로드됩니다. 하나는 연쇄상 구균 태그를 포함하거나 구슬에 부착 된 STREP 태그가 단백질에 결합하는 단백질은 용출된다. 국기 구슬 다음 연쇄상 구균 용출에 추가되었습니다. 하나는 FLAG 태그를 포함하거나 구슬에 부착 된 FLAG-태그 단백질에 결합하는 단백질은 용출된다. 용리는 지시 된 방법에 의해 분석 될 수있다.TTP : //ecsource-jove-com.remotexs.ntu.edu.sg/files/ftp_upload/55236/55236fig1large.jpg &quot;대상 =&quot;_ 빈 &quot;&gt;이 그림의 더 큰 버전을 보려면 여기를 클릭하십시오. <img alt="그림 2" src="/files/ftp_upload/55236/55236fig2.jpg" /> 그림 2 : TAP 전략의 도식 표현. TAP의 상세한 프로토콜. 자세한 내용은 텍스트를 참조하십시오. <a href="https://ecsource-jove-com.remotexs.ntu.edu.sg/files/ftp_upload/55236/55236fig2large.jpg" target="_blank">이 그림의 더 큰 버전을 보려면 여기를 클릭하십시오.</a> <img alt="그림 3" src="/files/ftp_upload/55236/55236fig3.jpg" /> 그림 3 : TAP 정화의 단계별 분석의 예. (A) TAP의 웨스턴 블롯 분석 (CycT1 : S 및 경우, Cdk9 : F). (B) 상호 TAP의 웨스턴 블롯 분석 (경우, Cdk9 : S 및 CycT1 : F). 이리저리전체 세포 용 해물, 5 μL (0.2 %)의 m 1 ml를 같이로드 &quot;STREP AP 입력.&quot; 나머지 전체 세포 용 해물의 975 μL은 연쇄상 구균 STREP AP에 대한 구슬과 &quot;STREP AP 용출&quot;100 ㎕ 수집에 추가되었습니다. 이로부터 5 μL (2 %)로드이었다. 은 &quot;STREP AP 용출&quot;80 μL는 FLAG 플래그는 IP에 대한 구슬과 &quot;FLAG IP 용출&quot;30 μL 수집에 추가되었습니다. &quot;FLAG IP 용출&quot;의 30 μL에서 7 μL (23.3 %)을로드했습니다. (C) TAP의 실버 얼룩 분석 (CycT1 : S 및 경우, Cdk9 : F)를. (: S 및 CycT1 : 경우, Cdk9 F) 상호 TAP의 (D) 실버 얼룩 분석. &quot;STREP AP 용출&quot;및 &quot;FLAG IP 용출&quot;7 μL (23.3 %)의 5 μL (2 %)을 장착 하였다. 별표는 공동 용출 불순물을 나타냅니다. <a href="https://ecsource-jove-com.remotexs.ntu.edu.sg/files/ftp_upload/55236/55236fig3large.jpg" target="_blank">이 그림의 더 큰 버전을 보려면 여기를 클릭하십시오.</a> <table fo:keEP-together.within 페이지 = &quot;1&quot;fo를 : 유지 -에 - next.within 페이지 = &quot;항상&quot;&gt; <tbody><tr><td> 단백질 </td><td> 잔류 </td><td> 벡터 </td><td> 꼬리표 </td><td> 복제 사이트 </td><td> 참고 </td></tr><tr><td> CycT1 </td><td> 1-708 </td><td> pcDNA 벡터 / 4TO </td><td> STREP </td><td> HindIII로 -를 EcoRI </td><td> 맥나마라는 등. 2013 년 10 </td></tr><tr><td> CycT1 </td><td> 1-708 </td><td> pcDNA 벡터 / 4TO </td><td> 깃발 </td><td> HindIII로 -를 EcoRI </td><td> 이 문서 </td></tr><tr><td> 경우, Cdk9 </td><td> 1-372 </td><td> pcDNA 벡터 / 4TO </td><td> STREP </td><td> HindIII로 - XhoI에 </td><td> 이 문서 </td></tr><tr><td> 경우, Cdk9 </td><td> 1-372 </td><td> pcDNA 벡터 / 4TO </td><td> FLAG </td><td> HindIII로 - XhoI에 </td><td> 맥나마라 외. 2013 년 (10) </td></tr><tr><td> GFP </td><td> 1-238 </td><td> pcDNA 벡터 / 4TO </td><td> STREP-FLAG </td><td> 을 BamHI - XhoI에 </td><td> 이 문서 </td></tr></tbody></table> 표 1 :이 연구에서 사용 된 플라스미드. CycT1 및 경우, Cdk9은 pcDNA 벡터 / 4TO-STREP 및 pcDNA 벡터 / 4TO-FLAG 플라스미드 벡터로 결찰 하였다. 이러한 구조는 DH5α 유능한 세포로 형질 전환 및 LB-암피실린 판에 도금했다. 식민지는, 선택 성장 및 스크린 하였다. 성공적 결찰 클론 생거 시퀀싱 및 제한 분해 및 아가 로스 겔 전기 이동의 조합에 의해 확인 하였다. 대신 전체 길이 (1-726) 풍부한 지난 18 잔류 물은 해충 시퀀스를 포함하기 때문에 (펩타이드 서열 - CycT1 위해 우리는 짧은 버전 (708 일)을 사용단백질 분해 (20)의 신호 펩티드로서 작용 프롤린, 글루탐산, 세린, 및 트레오닌). 경우, Cdk9는 전체 길이였다. 다음과 같이 직렬 연쇄상 구균 태그의 순서는 다음과 같습니다 GGGGWSHPQFEKGGGSGGGSGGGSWSHPQFEK. 다음과 같이 직렬 FLAG 태그의 순서는 다음과 같습니다 GGGGDYKDHDGDYKDHDIDYKDDDDK. 표 2 : 문제 해결 표. 문제 해결을 시작하기 전에 두 번 검사는 각 필수 단계는 다음되었음을 확인합니다. 이 프로토콜의 특정 단계는 예상 된 결과를 달성하기 위해 다른 사람보다 더 최적화가 필요합니다. <a href="https://ecsource-jove-com.remotexs.ntu.edu.sg/files/ftp_upload/55236/Book2.xlsx">이 파일을 다운로드하려면 여기를 클릭하십시오.</a>

Watch this Scientific Journal Video about Tandem Affinity Purification of Protein Complexes from Eukaryotic Cells at JoVE.com

Tandem Affinity Purification of Protein Complexes from Eukaryotic Cells

We describe here a novel, robust, and efficient tandem affinity purification (TAP) method for the expression, isolation, and characterization of protein complexes from eukaryotic cells. This protocol could be utilized for the biochemical characterization of discrete complexes as well as the identification of novel interactors and post-translational modifications that regulate their function.

진핵 세포에서 단백질 복합체의 탠덤 선호도 정화

The purification of active protein-protein and protein-nucleic acid complexes is crucial for the characterization of enzymatic activities and de novo ...

tandem-affinity-purification-protein-complexes-from-eukaryotic

Nanyang Technological University

Research

JoVE Journal

Biochemistry

14.8K 조회수.  The University of Texas Southwestern Medical Center. We describe here a novel, robust, and efficient tandem affinity purification (TAP) method for the expression, isolation, and characterization of protein complexes from eukaryotic cells. This protocol could be utilized for the biochemical characterization of discrete complexes as well as the identification of novel interactors and post-translational modifications that regulate their function.

비디오: Tandem Affinity Purification of Protein Complexes from Eukaryotic Cells

Isolation of Cognate RNA-protein Complexes from Cells Using Oligonucleotide-directed Elution

Ribonucleoprotein particles direct the biogenesis and post-transcriptional regulation of all mRNAs through distinct combinations of RNA binding proteins. They are composed of position-dependent, cis-acting RNA elements and unique combinations of RNA binding proteins. Defining the composition of a specific RNP is essential to achieving a fundamental understanding of gene regulation. The isolation of a select RNP is akin to finding a needle in a haystack. Here, we demonstrate an approach to isolate RNPs associated at the 5' untranslated region of a select mRNA in asynchronous, transfected cells. This cognate RNP has been demonstrated to be necessary for the translation of select viruses and cellular stress-response genes.
The demonstrated RNA-protein co-precipitation protocol is suitable for the downstream analysis of protein components through proteomic analyses, immunoblots, or suitable biochemical identification assays. This experimental protocol demonstrates that DHX9/RNA helicase A is enriched at the 5' terminus of cognate retroviral RNA and provides preliminary information for the identification of its association with cell stress-associated huR and junD cognate mRNAs.

This manuscript describes an approach to isolate select cognate RNPs formed in eukaryotic cells via a specific oligonucleotide-directed enrichment. We demonstrate the applicability of this approach by isolating a cognate RNP bound to the retroviral 5' untranslated region that is composed of DHX9/RNA helicase A.

올리고 뉴클레오티드 지시 용출을 사용하여 세포에서 동족 RNA 단백질 단지의 분리

Ribonucleoprotein particles direct the biogenesis and post-transcriptional regulation of all mRNAs through distinct combinations of RNA binding proteins. ...

연구

생화학

Protein Complex Affinity Capture from Cryomilled Mammalian Cells

Affinity capture is an effective technique for isolating endogenous protein complexes for further study. When used in conjunction with an antibody, this technique is also frequently referred to as immunoprecipitation. Affinity capture can be applied in a bench-scale and in a high-throughput context. When coupled with protein mass spectrometry, affinity capture has proven to be a workhorse of interactome analysis. Although there are potentially many ways to execute the numerous steps involved, the following protocols implement our favored methods. Two features are distinctive: the use of cryomilled cell powder to produce cell extracts, and antibody-coupled paramagnetic beads as the affinity medium. In many cases, we have obtained superior results to those obtained with more conventional affinity capture practices. Cryomilling avoids numerous problems associated with other forms of cell breakage. It provides efficient breakage of the material, while avoiding denaturation issues associated with heating or foaming. It retains the native protein concentration up to the point of extraction, mitigating macromolecular dissociation. It reduces the time extracted proteins spend in solution, limiting deleterious enzymatic activities, and it may reduce the non-specific adsorption of proteins by the affinity medium. Micron-scale magnetic affinity media have become more commonplace over the last several years, increasingly replacing the traditional agarose- and Sepharose-based media. Primary benefits of magnetic media include typically lower non-specific protein adsorption; no size exclusion limit because protein complex binding occurs on the bead surface rather than within pores; and ease of manipulation and handling using magnets.

Here we describe protocols to disrupt mammalian cells by solid-state milling at a cryogenic temperature, produce a cell extract from the resulting cell powder, and isolate protein complexes of interest by affinity capture upon antibody-coupled micron-scale paramagnetic beads.

Cryomilled 포유 동물 세포에서 단백질 단지 선호도 캡처

Affinity capture is an effective technique for isolating endogenous protein complexes for further study. When used in conjunction with an antibody, this ...

Resolving Affinity Purified Protein Complexes by Blue Native PAGE and Protein Correlation Profiling

Most proteins act in association with others; hence, it is crucial to characterize these functional units in order to fully understand biological processes. Affinity purification coupled to mass spectrometry (AP-MS) has become the method of choice for identifying protein-protein interactions. However, conventional AP-MS studies provide information on protein interactions, but the organizational information is lost. To address this issue, we developed a strategy to unravel the distinct functional assemblies a protein might be involved in, by resolving affinity-purified protein complexes prior to their characterization by mass spectrometry. Protein complexes isolated through affinity purification of a bait protein using an epitope tag and competitive elution are separated through blue native electrophoresis. Comparison of protein migration profiles through correlation profiling using quantitative mass spectrometry allows assignment of interacting proteins to distinct molecular entities. This method is able to resolve protein complexes of close molecular weights that might not be resolved by traditional chromatographic techniques such as gel filtration. With little more work than conventional AP-geLC-MS/MS, we demonstrate this strategy may in many cases be adequate for obtaining protein complex topological information concomitantly to identifying protein interactions.

Here we present protocols for affinity purification of protein complexes and their separation by blue native PAGE, followed by protein correlation profiling using label free quantitative mass spectrometry. This method is useful to resolve interactomes into distinct protein complexes.

블루 기본 페이지와 단백질 상관 관계 프로파일 링에 의한 선호도 정제 단백질 복합체 해결

Most proteins act in association with others; hence, it is crucial to characterize these functional units in order to fully understand biological ...

2 in 1: One-step Affinity Purification for the Parallel Analysis of Protein-Protein and Protein-Metabolite Complexes

Cellular processes are regulated by interactions between biological molecules such as proteins, metabolites, and nucleic acids. While the investigation of protein-protein interactions (PPI) is no novelty, experimental approaches aiming to characterize endogenous protein-metabolite interactions (PMI) constitute a rather recent development. Herein, we present a protocol that allows simultaneous characterization of the PPI and PMI of a protein of choice, referred to as bait. Our protocol was optimized for Arabidopsis cell cultures and combines affinity purification (AP) with mass spectrometry (MS)-based protein and metabolite detection. In short, transgenic Arabidopsis lines, expressing bait protein fused to an affinity tag, are first lysed to obtain a native cellular extract. Anti-tag antibodies are used to pull down protein and metabolite partners of the bait protein. The affinity-purified complexes are extracted using a one-step methyl tert-butyl ether (MTBE)/methanol/water method. Whilst metabolites separate into either the polar or the hydrophobic phase, proteins can be found in the pellet. Both metabolites and proteins are then analyzed by ultra-performance liquid chromatography-mass spectrometry (UPLC-MS or UPLC-MS/MS). Empty-vector (EV) control lines are used to exclude false positives. The major advantage of our protocol is that it enables identification of protein and metabolite partners of a target protein in parallel in near-physiological conditions (cellular lysate). The presented method is straightforward, fast, and can be easily adapted to biological systems other than plant cell cultures.

Protein-protein and protein-metabolite interactions are crucial for all cellular functions. Herein, we describe a protocol that allows parallel analysis of these interactions with a protein of choice. Our protocol was optimized for plant cell cultures and combines affinity purification with mass spectrometry-based protein and metabolite detection.

2 1: 원스텝 단백질 단백질과 단백질 대사 산물 단지의 병렬 분석에 대 한 친 화력 정화

Cellular processes are regulated by interactions between biological molecules such as proteins, metabolites, and nucleic acids. While the investigation of ...

An Oligonucleotide-based Tandem RNA Isolation Procedure to Recover Eukaryotic mRNA-Protein Complexes

RNA-binding proteins (RBPs) play key roles in the post-transcriptional control of gene expression. Therefore, biochemical characterization of mRNA-protein complexes is essential to understanding mRNA regulation inferred by interacting proteins or non-coding RNAs. Herein, we describe a tandem RNA isolation procedure (TRIP) that enables the purification of endogenously formed mRNA-protein complexes from cellular extracts. The two-step protocol involves the isolation of polyadenylated mRNAs with antisense oligo(dT) beads and subsequent capture of an mRNA of interest with 3&#39;-biotinylated 2&#39;-O-methylated antisense RNA oligonucleotides, which can then be isolated with streptavidin beads. TRIP was used to recover in vivo crosslinked mRNA-ribonucleoprotein (mRNP) complexes from yeast, nematodes and human cells for further RNA and protein analysis. Thus, TRIP is a versatile approach that can be adapted to all types of polyadenylated RNAs across organisms to study the dynamic re-arrangement of mRNPs imposed by intracellular or environmental cues.

A tandem RNA isolation procedure (TRIP) for recovery of endogenously formed mRNA-protein complexes is described. Specifically, RNA-protein complexes are crosslinked in vivo, polyadenylated RNAs are isolated from extracts with oligo(dT) beads, and particular mRNAs are captured with modified RNA antisense oligonucleotides. Proteins bound to mRNAs are detected by immunoblot analysis.

진 핵 세포 mRNA 단백질 복합물을 복구 하는 Oligonucleotide 기반 협동 RNA 격리 절차

RNA-binding proteins (RBPs) play key roles in the post-transcriptional control of gene expression. Therefore, biochemical characterization of mRNA-protein ...

Affinity Purification of Chloroplast Translocon Protein Complexes Using the TAP Tag

Chloroplast biogenesis requires the import of thousands of nucleus-encoded proteins into the plastid. The import of these proteins depends on the translocon at the outer (TOC) and inner (TIC) chloroplast membranes. The TOC and TIC complexes are multimeric and probably contain yet unknown components. One of the main goals in the field is to establish the complete inventory of TOC and TIC components. For the isolation of TOC-TIC complexes and the identification of new components, the preprotein receptor TOC159 has been modified N-terminally by the addition of the tandem affinity purification (TAP) tag resulting in TAP-TOC159. The TAP-tag is designed for two sequential affinity purification steps (hence "tandem affinity"). The TAP-tag used in these studies consists of a N-terminal IgG-binding domain derived from Staphylococcus aureus Protein A (ProtA) followed by a calmodulin-binding peptide (CBP). Between these two affinity tags, a tobacco etch virus (TEV) protease cleavage site has been included. Therefore, TEV protease can be used for gentle elution of TOC159-containing complexes after binding to IgG beads. In the protocol presented here, the second Calmodulin-affinity purification step was omitted. The purification protocol starts with the preparation and solubilization of total cellular membranes. After the detergent-treatment, the solubilized membrane proteins are incubated with IgG beads for the immunoisolation of TAP-TOC159-containing complexes. Upon binding and extensive washing, TAP-TOC159 containing complexes are cleaved and released from the IgG beads using the TEV protease whereby the S. aureus IgG-binding domain is removed. Western blotting of the isolated TOC159-containing complexes can be used to confirm the presence of known or suspected TOC and TIC proteins. More importantly, the TOC159-containing complexes have been used successfully to identify new components of the TOC and TIC complexes by mass spectrometry. The protocol that we present potentially allows the efficient isolation of any membrane-bound protein complex to be used for the identification of yet unknown components by mass spectrometry.

We here present a proven and tested protocol for the purification of chloroplast protein import complexes (TOC-TIC complex) using the TAP-tag. The one-step affinity-isolation protocol can potentially be applied to any protein and be used to identify new interaction partners by mass spectrometry.

탭 태그를 사용 하 여 엽록체 Translocon 단백질 복합물의 친 화력 정화

Chloroplast biogenesis requires the import of thousands of nucleus-encoded proteins into the plastid. The import of these proteins depends on the ...

Expression, Solubilization, and Purification of Eukaryotic Borate Transporters

The Solute Carrier 4 (SLC4) family of proteins is called the bicarbonate transporters and includes the archetypal protein Anion Exchanger 1 (AE1, also known as Band 3), the most abundant membrane protein in the red blood cells. The SLC4 family is homologous with borate transporters, which have been characterized in plants and fungi. It remains a significant technical challenge to express and purify membrane transport proteins to homogeneity in quantities suitable for&#160;structural or functional studies. Here we describe detailed procedures for the overexpression of borate transporters in Saccharomyces cerevisiae, isolation of yeast membranes, solubilization of protein by detergent, and purification of borate transporter homologs from S. cerevisiae, Arabidopsis thaliana, and Oryza sativa. We also detail a glutaraldehyde cross-linking experiment to assay multimerization of homomeric transporters. Our generalized procedures can be applied to all three proteins and have been optimized for efficacy. Many of the strategies developed here can be utilized for the study of other challenging membrane proteins.

Here we present a protocol to express, solubilize, and purify several eukaryotic borate transporters with homology to the SLC4 transporter family using yeast. We also describe a chemical cross-linking assay to assess the purified homomeric proteins for multimeric assembly. These protocols can be adapted for other challenging membrane proteins.

표현, 가용 화, 그리고 진 핵 Borate 전송기의 정화

The Solute Carrier 4 (SLC4) family of proteins is called the bicarbonate transporters and includes the archetypal protein Anion Exchanger 1 (AE1, also ...

Translating Ribosome Affinity Purification (TRAP) for RNA Isolation from Endothelial Cells In Vivo

Many studies have been limited to using in vitro cellular assays and whole tissues or isolating of specific cell types from animals for in vitro analysis of transcriptome and gene expression by qPCR and RNA sequencing. Comprehensive transcriptome and gene expression analysis of specific cell types in complex tissues and organs will be critical to understand cellular and molecular mechanisms by which genes are regulated and their association with tissue homeostasis and organ functions. In this article, we demonstrate the methodology for isolation of ribosome-bound RNA directly in vivo in the vascular endothelia of animal lungs as an example. The specific materials and procedures for tissue processing and RNA purification will be described, including the assessment of RNA quality and yield as well as real time qPCR for arteriogenic gene assays. This approach, known as translating ribosome affinity purification (TRAP) technique, can be utilized for characterization of gene expression and transcriptome analysis of certain cell types directly in vivo in any specific type in complex tissues.

Translating Ribosome Affinity Purification TRAP for RNA Isolation from Endothelial Cells In Vivo

We present an approach to purify ribosome-bound mRNA from vascular endothelial cells (ECs) directly in mouse brain, lung and heart tissues via EC-specific genetic tag of enhanced green fluorescence protein (EGFP)in ribosomes in combination with RNA purification.

생체 내피 세포에서 RNA 격리를 위한 리보솜 친화성 정제(TRAP) 번역

Many studies have been limited to using in vitro cellular assays and whole tissues or isolating of specific cell types from animals for in vitro analysis ...

Bacterial Expression and Purification of Human Matrix Metalloproteinase-3 using Affinity Chromatography

Matrix metalloproteinases (MMPs) belong to the family of metzincin proteases with central roles in extracellular matrix (ECM) degradation and remodeling, as well as interactions with several growth factors and cytokines. Overexpression of specific MMPs is responsible in several diseases such as cancer, neurodegenerative diseases, and cardiovascular disease. MMPs have been the center of attention recently as targets to develop therapeutics that can treat diseases correlated to MMP overexpression.
To study the MMP mechanism in solution, more facile and robust recombinant protein expression and purification methods are needed for the production of active, soluble MMPs. However, the catalytic domain of most MMPs cannot be expressed in Escherichia coli (E. coli) in soluble form due to lack of posttranslational machinery, whereas mammalian expression systems are usually costly and have lower yields. MMP inclusion bodies must undergo the tedious and laborious process of extensive purification and refolding, significantly reducing the yield of MMPs in native conformation. This paper presents a protocol using Rosetta2(DE3)pLysS (hereafter referred to as R2DP) cells to produce matrix metalloproteinase-3 catalytic domain (MMP-3cd), which contains an N-terminal His-tag followed by pro-domain (Hisx6-pro-MMP-3cd) for use in affinity purification. R2DP cells enhance the expression of eukaryotic proteins through a chloramphenicol-resistant plasmid containing codons normally rare in bacterial expression systems. Compared to the traditional cell line of choice for recombinant protein expression, BL21(DE3), purification using this new strain improved the yield of purified Hisx6-pro-MMP-3cd. Upon activation and desalting, the pro domain is cleaved along with the N-terminal His-tag, providing active MMP-3cd for immediate use in countless in vitro applications. This method does not require expensive equipment or complex fusion proteins and describes rapid production of recombinant human MMPs in bacteria.

His-tag purification, dialysis, and activation are employed to increase yields of soluble, active matrix metalloproteinase-3 catalytic domain protein expression in bacteria. Protein fractions are analyzed via SDS-PAGE gels.

박테리아 발현 및 친화성 크로마토그래피를 이용한 인간 매트릭스 메탈로프로테이나제-3의 정제

Matrix metalloproteinases (MMPs) belong to the family of metzincin proteases with central roles in extracellular matrix (ECM) degradation and remodeling, ...

Extraction and Purification of FAHD1 Protein from Swine Kidney and Mouse Liver

Fumarylacetoacetate hydrolase domain-containing protein 1 (FAHD1) is the first identified member of the FAH superfamily in eukaryotes, acting as oxaloacetate decarboxylase in mitochondria. This article presents a series of methods for the extraction and purification of FAHD1 from swine kidney and mouse liver. Covered methods are ionic exchange chromatography with fast protein liquid chromatography (FPLC), preparative and analytical gel filtration with FPLC, and proteomic approaches. After total protein extraction, ammonium sulfate precipitation and ionic exchange chromatography were explored, and FAHD1 was extracted via a sequential strategy using ionic exchange and size-exclusion chromatography. This representative approach may be adapted to other proteins of interest (expressed at significant levels) and modified for other tissues. Purified protein from tissue may support the development of high-quality antibodies, and/or potent and specific pharmacological inhibitors.

This protocol describes how to extract fumarylacetoacetate hydrolase domain-containing protein 1 (FAHD1) from swine kidney and mouse liver. The listed methods may be adapted to other proteins of interest and modified for other tissues.