Research reported in this publication was supported by the National Institute of Allergy and Infectious Diseases (NIAID) of the NIH under award number R01AI114362 and Welch Foundation grant I-1782 to Iv&#225;n D'Orso.

1. Plating Cells <ol><li> Einen Tag vor der Transfektion Platte 3,5 x 10 6 HEK293T - Zellen in 10 ml Dulbecco-modifiziertem Eagle Medium (DMEM) , ergänzt mit 10% (v / v) fötalem Rinderserum (FBS) und 1% (v / v) Penicillin / Streptomycin (10.000 U / ml Lager) pro 100 mm Schale. Platte 3 bis 5 100 mm-Schalen pro Versuch / Zustand ausreichend Protein Erholung zu gewährleisten. HINWEIS: Die Anzahl der Platten hat für jedes Experiment / Bedingung bestimmt werden, die auf den Expressionsspiegel und die Löslichkeit des Proteinkomplex von Interesse verlassen wird. Alternativ, falls in größerem Maßstab Reinigung benötigt wird, können Zelllinien angepasst werden in Suspensionen in spinner flasks 2 zu wachsen, aber dieses Verfahren nicht für transiente Transfektionen arbeiten. </li></ol> 2. Transfektion von Zellen oder Induzierende stabilen Zelllinien <ol><li> Am folgenden Tag, überprüfen Sie die Zellen unter dem Mikroskop. 80% konfluent vor proce - Zellen müssen 70 seineding. </li><li> Transfizieren der Zellen mit einer Gesamtmischung von 7 &amp; mgr; g Plasmid-DNA und 21 &amp; mgr; l Transfektionsreagenz pro 100 mm-Schale. Transfizieren Zellen mit einem Vektor die GFP exprimieren (Tabelle 1) als Kontrolle für die Transfektionseffizienz. HINWEIS: Bei Verwendung eines HEK293-T-REx oder ähnliche stabile Zelllinie, die die Expression von zwei oder komplexeres Untereinheiten in Reaktion auf Doxycyclin 14, 15 induziert wird der Induktor haben zu den Zellen hinzugefügt werden und für 48 Stunden inkubiert. Ähnlich wird eine stabile Zelllinie, die die Expression von GFP bei der Zugabe des Induktors auch zu Validierungszwecken erforderlich wäre induziert. Gehen 2.7 zu treten. </li><li> Bereiten Sie die Transfektionsgemischs pro 100 mm Schale. In einem 1,5 ml Mikrozentrifugenröhrchen mit 7 ug Gesamt-Plasmid-DNA (entsprechend zwei oder mehreren Plasmiden) 500 ul DMEM unsupplementierten mischen. In einem separaten Reaktionsgefäß, mischen 500 ul unsupplementierten DMEM with 21 ul des Transfektionsreagenz. Wiederholen Sie für jede Transfektionsreaktion. </li><li> Pipette, um die Transfektionsreagenz Lösung in die Plasmid-DNA-Lösung (nicht zu verwechseln Lösungen in umgekehrter Reihenfolge). Mischen von mindestens 4 mal Pipettieren. </li><li> Inkubieren dieser Mischung bei Raumtemperatur für 10 bis 15 min, aber nicht länger als 15 min. </li><li> Neigen die Platte einen Medienspeicher zu schaffen und Pipetten sorgfältig das Transfektionsgemisch tropfenweise auf die innere Seite der Platte, ohne die Zellen zu stören. Bringen Sie das Gericht auf seine ursprüngliche flache Position und vorsichtig schwenken die Mischung zu verteilen. </li><li> Inkubieren der Zellen bei 37 ° C in einer befeuchteten Zellkultur - Inkubator mit 5% CO 2 (dieser Zustand im folgenden als &quot;Gewebekultur - Inkubator&quot; bezeichnet wird). Ersetzen Sie die Medien 5 Stunden nach der Transfektion (optional). </li></ol> 3. Prüfung Transfection oder Induction Efficiency <ol><li> Bei 24 Stunden nach der Transfektion visualisieren die Zellen unter einer Grippeorescent Mikroskop für die Transfektionseffizienz (oder Induktion von Steuer HEK293T-REx stabile Zelllinie GFP-exprimierenden) zu überprüfen. Inkubieren für weitere 24 Stunden. </li></ol> 4. STREP Affinitätsreinigung (STREP AP) <ol><li> Das Sammeln der Zellen <ol><li> Bei 48 Stunden nach der Transfektion, entfernen Sie die Medien und 8 ml kaltem 1x phosphatgepufferter Salzlösung (PBS). Pipette nach oben und unten Zellen von der Platte zu lösen. </li><li> Sammeln Sie und übertragen Sie die Zellsuspension in einem 15 ml-Röhrchen und drehen Sie die Zellen bei 800 · g unten für 4 min bei 4 ° C. </li><li> Entfernen Sie den PBS Überstand. Wiederholen Sie den Spin-Down (800 × g für 1 min bei 4 ° C) restliche PBS zu beseitigen. Lagern Sie das Zellpellet bei -80 ° C für eine spätere Verwendung oder das Verfahren folgen unterhalb der Proteinreinigung fortzusetzen. </li></ol></li><li> Lyse der Zellen <ol><li> Resuspendieren der Pellets Zelle 5 × Zellpellet Volumen mit (~ 250 &amp; mgr; l pro Platte) Passive Lysis Buffer(PLB: 20 mM Tris-HCl pH 7,5, 150 mM NaCl, 1,5 mM MgCl 2, 1 mM DTT, Protease - Inhibitor - Cocktail - Tablette, 5% v / v Glycerin und 1,0% NP-40) und übertragen die Zellsuspension auf eine 1,5 ml Mikrozentrifugenröhrchen. </li><li> verwirbeln kurz die Suspension und Nutation für 30 min bei 4 ° C. </li><li> Drehen, um die Zellsuspension bei 10000 xg für 10 min bei 4 ° C. </li><li> Übertragen Sie die löslichen Lysate in ein neues 1,5-ml-Mikrozentrifugenröhrchen und entsorgen Sie die Zellpellets. Sparen Sie 10% des endgültigen Volumens des löslichen Lysat als &quot;STREP AP Input&quot;. Lagerung bei 4 ° C. </li></ol></li><li> Äquilibrieren der STREP Perlen HINWEIS: Verwenden Sie STREP Perlen zum ersten AP Schritt! Komplexe nach unten gezogen mit STREP Perlen als die deutlich mehr Protein erholen mit FLAG Perlen nach unten gezogen. <ol><li> Nehmen Sie (n 40 &amp; mgr; l ×) + n ul der 50% STREP Kügelchenaufschlämmung (n = Anzahl der Proben) und Spin-down bei 1.500 × g für 2 min bei 4 ° C. HINWEIS: Verwenden Sie Weit mouthed Tipps Pipette Perlen. </li><li> Entfernen Sie den Überstand und fügen 500 ul PLB an die Kügelchen. Nutiert die Perlen Gemisch 5 min bei 4 ° C. Spin down bei 1.500 × g für 2 min bei 4 ° C. <ol><li> Wiederholen für insgesamt 3 Waschungen. Resuspendieren der Kügelchen in PLB auf ein Endvolumen von n × 40 &amp; mgr; l. </li></ol></li><li> Werden 40 ul 50% STREP Kügelchenaufschlämmung zu jedem Zelllysat Probe und nutiert für 2 h bei 4 ° C. </li></ol></li><li> STREP AP <ol><li> Spin down-Lösung bei 1500 × g für 2 min bei 4 ° C. </li><li> Entfernen Sie den Überstand und speichern als &quot;STREP AP Durchfluss (FT)&quot; bei 4 ° C. </li><li> Hinzufügen 500 ul von Strep AP Waschpuffer I (20 mM Tris-HCl pH 7,5, 250 mM NaCl, 1,5 mM MgCl 2, 1 mM DTT, 5% Glycerin und 0,2% NP-40) an die Kügelchen. Nutiert die Perlen Gemisch 5 min bei 4 ° C und Zentrifugation bei 1.500 × g für 2 min bei 4 ° C. Überstand verwerfen. <ol><li> Wiederholen Sie dies für insgesamt 4 Wäschen. <br/&gt; Hinweis: Vor der vierten Wäsche, übertragen Sie die Perlen-Lösung in ein neues 1,5 ml Mikrozentrifugenröhrchen, das Protein Hintergrund zu reduzieren. Dieser Schritt ist wichtig. </li></ol></li><li> Hinzufügen, 500 &amp; mgr; l Waschpuffer II (100 mM Tris-HCl pH 8,0, 150 mM NaCl und 1 mM EDTA) und die Kügelchen äquilibrieren durch die Rohre zu invertieren. Spin down bei 1.500 × g für 2 min bei 4 ° C und den Überstand verwerfen. </li><li> Eluieren des Proteins von Interesse mit 50 ul von Strep Elutionspuffer (100 mM Tris-HCl pH 8,0, 150 mM NaCl, 1 mM EDTA und 2,5 mM Desthiobiotin). Vortex bei 800 Upm für 15 min bei 4 ° C. </li><li> Spin down die Perlen bei 1.500 × g für 1 min bei 4 ° C. Sammeln Sie den Überstand. Dieser Anteil entspricht dem &quot;STREP AP Elution&quot; Probe. </li><li> Speichern Sie die Perlen Fraktion bei 4 ° C für eine zweite Elution, die auf die Hälfte der Menge an Protein mit der ersten Elution erhalten ergeben könnte. Aliquot 10% des Strep AP Elution zur Silberfärbung und / oder Western-Blotting16. </li></ol></li><li> Äquilibrieren der FLAG - Perlen <ol><li> Nehmen Sie (nx 16 &amp; mgr; l) + n ul FLAG Perlen-Lösung (n = Anzahl der Proben) und Spin-down bei 1.500 × g für 2 min bei 4 ° C. HINWEIS: Verwenden Sie Weithals Tipps Pipette Perlen. </li><li> Entfernen Sie den Überstand und fügen 500 ul FLAG Waschpuffer (100 mM Tris-HCl pH 8,0, 150 mM NaCl, 1 mM EDTA und 0,1% NP-40) an die Kügelchen. Spin down bei 1.500 × g für 2 min bei 4 ° C. Wiederholen für insgesamt 3 Waschungen. </li><li> Resuspendieren der Kügelchen in FLAG Waschpuffer auf ein Endvolumen von 16 &amp; mgr; l nx. </li><li> Format 16 ul der FLAG Kügelchenaufschlämmung zum verbleibenden STREP AP Elution und nutiert über Nacht bei 4 ° C. </li></ol></li></ol> 5. FLAG IP <ol><li> Spin down die FLAG Perlen Suspension bei 1500 × g für 2 min bei 4 ° C. Speichern Sie den Überstand und speichern als &quot;FLAG IP Flow-through&quot; (FT) bei 4 ° C. </li><li> In 50081; l von FLAG Waschpuffer zur Lösung. Nutiert für 5 min bei 4 ° C und Zentrifugation bei 1.500 × g für 2 min bei 4 ° C. Wiederholen Sie dies für insgesamt 4 Waschungen und entfernen Sie den Überstand nach jeder Wäsche. HINWEIS: Vor der vierten Wäsche, übertragen Sie die Protein-Kügelchen-Lösung in ein neues 1,5 ml Mikrozentrifugenröhrchen Hintergrund zu reduzieren. Dieser Schritt ist wichtig. </li><li> Entfernen Sie den Überstand aus dem letzten Spin und fügen Sie 30 ul Waschpuffer FLAG, die 200 ng / ul FLAG-Peptid in die Kügelchen. Vortex bei 800 Upm für 2 h bei 4 ° C. </li><li> Spin down die Suspension bei 1500 × g für 2 min bei 4 ° C. Ernten Sie den Überstand und lagern bei 4 ° C als &quot;FLAG IP Elution.&quot; HINWEIS: Die Elution Proben kann durch Silberfärbung und / oder Western - Blot unter Verwendung von Standardprotokollen 16, und sind bereit für die weitere Proteintests bestätigt werden. Wenn eine Western-Blot-Einrichtung, mit allen folgenden Proben durchgeführt: (1) STREP AP Eingang, (2) STREP AP FT, (3) STREP AP Elutiauf, (4) FLAG IP FT, und (5) FLAG IP Elution. Volumes geladen wird für jedes Experiment ermittelt werden. Alle gesammelten Proben und Perlen können Kurzzeitspeicher gespeichert werden und bei -80 ° C zur Langzeitlagerung bei 4ºC. TAP Proben konnten durch Massenspektrometrie analysiert werden , um die Identität ihrer Komponenten zu überprüfen, neuartige posttranslationale Modifikationen (PTMs) zu identifizieren, und / oder jede neue Protein - Wechselwirkung zu entdecken , mit dem gereinigten Komplex 2, 17. Zu diesem Zweck wird nach einer Coomassie-Gel oder Silberfärbung ausgeführt wird, können Bänder aus dem Gel ausgeschnitten werden, um einen sauberen Skalpell. Mehrere ausgezeichnete Bewertungen, die Massenspektrometrie Methoden diskutieren wurden bisher 18 veröffentlicht, 19. </li></ol>

<ol>
	<li>Sharan, R., Ulitsky, I., Shamir, R. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Network-based+prediction+of+protein+function.">Network-based prediction of protein function.</a> Mol Syst Biol. 3, 88-99 (2007).</li><li>Jager, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Global+landscape+of+HIV-human+protein+complexes.">Global landscape of HIV-human protein complexes.</a> Nature. 481, 365-370 (2012).</li><li>Fields, S., Song, O. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+novel+genetic+system+to+detect+protein-protein+interactions.">A novel genetic system to detect protein-protein interactions.</a> Nature. 340, 245-246 (1989).</li><li>Luo, Y., Batalao, A., Zhou, H., Zhu, L. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Mammalian+two-hybrid+system:+a+complementary+approach+to+the+yeast+two-hybrid+system.">Mammalian two-hybrid system: a complementary approach to the yeast two-hybrid system.</a> Biotechniques. 22, 350-352 (1997).</li><li>Lee, C. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Coimmunoprecipitation+assay.">Coimmunoprecipitation assay.</a> Methods Mol Biol. 362, 401-406 (2007).</li><li>Puig, O., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+tandem+affinity+purification+(TAP)+method:+a+general+procedure+of+protein+complex+purification.">The tandem affinity purification (TAP) method: a general procedure of protein complex purification.</a> Methods. 24, 218-229 (2001).</li><li>Jager, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Purification+and+characterization+of+HIV-human+protein+complexes.">Purification and characterization of HIV-human protein complexes.</a> Methods. 53, 13-19 (2011).</li><li>Price, D. H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=P-TEFb,+a+cyclin-dependent+kinase+controlling+elongation+by+RNA+polymerase+II.">P-TEFb, a cyclin-dependent kinase controlling elongation by RNA polymerase II.</a> Mol Cell Biol. 20, 2629-2634 (2000).</li><li>Peterlin, B. M., Price, D. H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Controlling+the+elongation+phase+of+transcription+with+P-TEFb.">Controlling the elongation phase of transcription with P-TEFb.</a> Mol Cell. 23, 297-305 (2006).</li><li>McNamara, R. P., McCann, J. L., Gudipaty, S. A., D'Orso, I. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Transcription+factors+mediate+the+enzymatic+disassembly+of+promoter-bound+7SK+snRNP+to+locally+recruit+P-TEFb+for+transcription+elongation.">Transcription factors mediate the enzymatic disassembly of promoter-bound 7SK snRNP to locally recruit P-TEFb for transcription elongation.</a> Cell Rep. 5, 1256-1268 (2013).</li><li>Adelman, K., Lis, J. T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Promoter-proximal+pausing+of+RNA+polymerase+II:+emerging+roles+in+metazoans.">Promoter-proximal pausing of RNA polymerase II: emerging roles in metazoans.</a> Nat Rev Genet. 13, 720-731 (2012).</li><li>D'Orso, I. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=7SKiing+on+chromatin:+move+globally,+act+locally.">7SKiing on chromatin: move globally, act locally.</a> RNA Biol. 13, 545-553 (2016).</li><li>McNamara, R. P., Bacon, C. W., D'Orso, I. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Transcription+Elongation+Control+by+the+7SK+snRNP+Complex:+Releasing+the+Pause.">Transcription Elongation Control by the 7SK snRNP Complex: Releasing the Pause.</a> Cell Cycle. 15, 2115-2123 (2016).</li><li>Yao, F., Svensjo, T., Winkler, T., Lu, M., Eriksson, C., Eriksson, E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Tetracycline+repressor,+tetR,+rather+than+the+tetR-mammalian+cell+transcription+factor+fusion+derivatives,+regulates+inducible+gene+expression+in+mammalian+cells.">Tetracycline repressor, tetR, rather than the tetR-mammalian cell transcription factor fusion derivatives, regulates inducible gene expression in mammalian cells.</a> Hum Gene Ther. 9, 1939-1950 (1998).</li><li>McNamara, R. P., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=KAP1+Recruitment+of+the+7SK+snRNP+Complex+to+Promoters+Enables+Transcription+Elongation+by+RNA+Polymerase+II.">KAP1 Recruitment of the 7SK snRNP Complex to Promoters Enables Transcription Elongation by RNA Polymerase II.</a> Mol Cell. 61, 39-53 (2016).</li><li>Ausubel, F. M., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=.">.</a> Current Protocols in Molecular Biology. , (1994).</li><li>Trudgian, D. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Comparative+evaluation+of+label-free+SINQ+normalized+spectral+index+quantitation+in+the+central+proteomics+facilities+pipeline.">Comparative evaluation of label-free SINQ normalized spectral index quantitation in the central proteomics facilities pipeline.</a> Proteomics. 11, 2790-2797 (2011).</li><li>Choudhary, C., Mann, M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Decoding+signalling+networks+by+mass+spectrometry-based+proteomics.">Decoding signalling networks by mass spectrometry-based proteomics.</a> Nat Rev Mol Cell Biol. 11, 427-439 (2010).</li><li>Bensimon, A., Heck, A. J., Aebersold, R. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Mass+spectrometry-based+proteomics+and+network+biology.">Mass spectrometry-based proteomics and network biology.</a> Annu Rev Biochem. 81, 379-405 (2012).</li><li>Rogers, S., Wells, R., Rechsteiner, M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Amino+acid+sequences+common+to+rapidly+degraded+proteins:+the+PEST+hypothesis.">Amino acid sequences common to rapidly degraded proteins: the PEST hypothesis.</a> Science. 234, 364-368 (1986).</li></ol>

The authors have nothing to disclose.

Das hier beschriebene Protokoll für die Expression und Isolierung von Proteinkomplexen aus eukaryotischen Zellen ist nicht auf die biochemische Charakterisierung solcher molekularen Anordnungen beschränkt, sondern kann auch für die Identifizierung von neuen Interaktoren und post-translationalen Modifikationen verwendet werden, die ihre Funktion regulieren könnte. Die Verwendung von Affinitätsmarkierungen ist nicht beschränkt auf das, was in diesem Protokoll genannt wird; aber unsere Erfahrung legt nahe, dass STREP als ersten Schritt unter Verwendung von AP signifikant die Ausbeute des endgültigen Protein-Protein-Komplex verbessert. Sowohl die Bindungs- und Elutionsschritte zu und von den Strep - Perlen sind extrem effizient im Vergleich zu anderen Epitop - Tags (zB FLAG). Darüber hinaus in der Theorie, TAP an andere Proteine oder Domänen mit einigen kleineren Optimierungen angewendet werden könnten, wie beispielsweise Pufferbedingungen, die Anzahl der Platten pro Experiment (für beide transient und stabil exprimierende Systemen) usw. Weiterhin kann die TAP - Methode auch sein , angewandten to andere Zelllinien, wenn bestimmte Proteinkomplexe erfordern ein spezielles System für ihre Funktion oder ihre Wechselwirkungen mit einzigartigen Faktoren. Zur Erleichterung der Fehlersuche, ist es sehr empfehlenswert , dass die Eingangs- und FT - Proben sowohl gespeichert werden (Tabelle 2). Wenn die erwarteten Proteinbanden nicht in der Elution dargestellt werden, können die FT Proben verwendet werden, um das Experiment zu beheben und zu bestimmen, ob die Probe gebunden hatten, und / oder aus der Kügelchen eluiert. Eine erfolgreiche TAP ist streng abhängig von hohen Niveaus der Proteinexpression und Erholung. Somit würde Forscher haben die Menge an Ausgangsmaterial auf einer Fall-zu-Fall-Basis zu optimieren. Wenn transiente Transfektion verwendet Proteinkomponenten zu exprimieren, sollte die Transfektionseffizienz mindestens 70% sein, bevor mit dem zweiten Schritt des TAP fortfahren. Der reziproke TAP-Verfahren (in dem die Epitope zwischen den beiden Köder vertauscht sind) hilft in der Regel bei der Bestimmung der experimentellen Strategiesollte die beste Ausbeute und Reinheit zu erreichen, verwendet werden. Auch hier wird sich dies auf einer Fall-zu-Fall-Basis untersucht werden. Wichtig ist, bestätigt auch gegenseitige TAP Durchführung, dass die PPI verwendet der Affinitätsmarkierung unabhängig ist. Einige Aspekte der TAP hier vorgestellte Methode haben ihre Grenzen. Zum Beispiel könnte die FLAG- und Strep-markierte Proteine ​​überexprimieren erzeugen Artefakte für die ektopisch exprimierten Proteins selbst oder deren Interaktoren. Unterschiedliche Epitop-Tags können Proteinexpressionsmengen, Proteinkonformation und / oder der subzellulären Lokalisation beeinflussen. Neben der Zelllinie und Transfektionseffizienz Einschränkung, die Größe der Komplexe aufgereinigt werden könnte ein Problem sein. Dieses TAP Methode eignet sich gut für Multi-Untereinheiten-Protein-Komplexen. Aus unserer Erfahrung können vier Komponenten durch Silberfärbung nachgewiesen werden (Daten nicht gezeigt). Wenn jedoch die Verwendung von zwei-markierten Komponenten, die anderen Interaktoren können nicht identisch stöchiometrischen Niveaus co-gereinigt werden. Deswegen,für diesen besonderen Ziel, die Verwendung von Zelllinien, die unteren Ebenen der Expression der komplexen Komponenten induziert wird empfohlen. Eine weitere Einschränkung würde die Stärke des PPI sein. Wenn die Wechselwirkungen nicht stabil genug sind, könnten einige Komponenten während der Reinigungsschritte (insbesondere in der letzten FLAG IP Schritt) verloren. Die TAP - Verfahren wurde zuvor beschrieben und verschiedene Epitop - Tags wurden getestet, validiert und 6 verglichen. Allerdings ist die TAP-Methode in diesem Artikel vorgestellten neuartigen und bietet eine einfache, effiziente, robuste und alternative Strategie zu PPIs, komplexe Montage studieren, und Protein-Netzwerk Zusammensetzung und Funktion schließen. Im Vergleich zu früheren Methoden TAP dieses Strep-FLAG ermöglicht TAP Strategie für die schnelle Reinigung von Komplexen für die weitere Charakterisierung, ohne vorherige Kenntnis der komplexen Zusammensetzung, Aktivität oder Funktion; und ohne die Notwendigkeit von Protease - Spaltung (zB TEV) für die Protein - Elution (which kann deutlich Proteinausbeute) zu verringern. Aufgrund des erhöhten Proteinkomplex Erholung das Strep-FLAG TAP - Verfahren ermöglicht auch die robuste Identifikation von Proteinen , die mit dem Proteinkomplex von Interesse in Zellen durch Tandem - Massenspektrometrie - Analyse 10, 15 zuzuordnen. Anschließend können andere Verfahren, wie die konfokale Mikroskopie, Grßenausschlußchromatographie, und Co-IP-Assays können auch die PPIs zur Validierung verwendet werden kann. Schließlich schlagen wir vor, dass eine alternative Version des TAP-Protokolls angepasst werden, um die Montage von diskreten Protein-RNA-Komplexe zu reinigen und zu untersuchen, die ungeheuer Forscher auf dem Gebiet der Biologie RNA helfen. Zusammenfassend stellen wir ein Verfahren zur Reinigung und PPIs in Säugetierzelllinien charakterisieren. Wir schlagen vor, dass diese Methode die Grundlage für die zukünftige Charakterisierung und funktionelle Analyse von vielen neuartigen Proteinkomplexe legt.

<html> Protein-Protein - Wechselwirkungen (PPIs) sind entscheidend für die genaue Regulierung der biologischen Prozesse 1, und weitere Studien auf diesen PPIs kann 2 um ihre Funktion zu informieren. Mehrere Ansätze wurden für die Untersuchung und Charakterisierung von EPI sowie für die de novo - Identifizierung neuer regulatorischer Proteinkomponenten entwickelt. Stanley Felder und Kollegen 1989, berichtete die Hefe - Zwei-Hybrid (Y2H) Test 3. Dieser Ansatz ermöglicht die unvoreingenommene und umfassende Identifizierung von Interaktoren (Beuten) für ein definiertes Protein von Interesse (Köder) in Saccharomyces cerevisiae. Neben der bemerkenswerten Nutzen für die Entdeckung PPIs kann der Y2H Assay zur Charakterisierung von Protein-Paare in Hefezellen verwendet werden, definieren eine minimale Interaktion Domänen und Identifizierung Mutationen, die derartige Wechselwirkungen aufheben. Durch Modifizieren der Y2H Assay kann PPIs auch in Säugerzellen untersucht werden,class = &quot;xref&quot;&gt; 4. Variationen des Y2H Assay (zB Hefe Drei-Hybrid - System) kann auch zu studieren Protein-RNA und Protein-small organischen Liganden - Wechselwirkungen in Zellen angewendet werden. Ein weiteres häufig verwendetes Werkzeug PPIs in einem homologen System zu studieren , ist die Co-Immunopräzipitation (Co-IP) Assay 5. Durch die Verwendung eines Antikörpers für ein Protein von Interesse zu immunpräzipitieren, erlaubt die Co-IP-Assay Forscher PPIs in Zellen für die verschiedenen Umgebungsbedingungen und experimentelle Situationen zu überwachen. Die Verwendung von Epitop-markierten Proteinen (zB FLAG, Myc, Strep, und HA, ua) in der Affinitätsreinigung (AP) Verfahren , um die Isolierung von Proteinen aus komplexen Proteingemischen für mehrere Downstream - Assays erleichtert hat, einschließlich Western - Blot, silver stain und enzymatische Analyse. Jedoch keiner dieser früheren Ansätze ermöglichen die Isolierung von großen Mengen an Protein - Komplexe zur weiteren Charakterisierung einschließlich in vitro assays, Entdeckung der regulatorischen Untereinheiten durch Massenspektrometrie, und Identifizierung von post-translationalen Modifikationen. Eine verbesserte Version des AP Methode Tandem AP (TAP) bezeichnet, die EPI für die Untersuchung durch die Schaffung eines Fusionsproteins mit zwei Epitope ein Reinigungsverfahren, das 6 bis zwei aufeinanderfolgende APs gereinigt wird, 7. In diesem Artikel stellen wir eine Variation des TAP Verfahren zur Reinigung von Protein-Komplexe, in denen zwei Untereinheiten mit unterschiedlichen Epitopen markiert werden und dann durch zwei aufeinanderfolgende APs (STREP AP gefolgt von einer FLAG IP) gereinigt. Wir bieten zunächst eine minimalistische Übersicht über TAP (Abbildung 1) und dann eine detaillierte Beschreibung aller experimentellen Schritte (Abbildung 2), so dass die Forscher sie auf ihre Proteinkomplex von Interesse anwenden können. Um die Anwendbarkeit des TAP-Methode zu demonstrieren, haben wir uns für eine gut charakterisierte Cyclin-CDK-Komplex (bezeichnet als PTEFB - kinase), die aus der regulatorischen Untereinheit Cyclin T1 (CycT1) und eine kinase (CDK9) zusammengesetzt ist, und ist an der Regulation der Transkription durch RNA - Polymerase II (Pol II) 8, 9 beteiligt sind , 10. P-TEFb phosphoryliert die C-terminale Domäne von Pol II und den damit verbundenen negativen Elongationsfaktoren, die an der transkriptionalen Promotor Pausieren entlastet und erleichtert dadurch Transkriptionselongation 11, 12, 13. Bei dieser bekannten Interaktion im Auge, STREP-tagged CycT1 und FLAG-markierten CDK9 waren über in HEK293T-Zellen exprimiert. Eine reziproke TAP Experiment wurde mit Strep-tagged CDK9 und FLAG-markiertes CycT1 geführt weiter zu bestätigen, dass die Protein-Interaktion ist unabhängig von der verwendeten Epitope. Die Zellen wurden gesammelt und lysiert 48 h nach der Transfektion. Das lösliche Lysat durch TAP gereinigt (STREP AP gefolgt von FLAGIP). Eingangs- und gereinigten Proteine wurden durch Western Blot und Silberfärbung (Abbildung 3) analysiert.

<table border="1" fo:keep-together.within-page="1" fo:keep-with-next.within-page="always">
	<tbody>
		<tr>
			<td>Dulbecco&#39;s Modified Eagle Medium (DMEM)</td>
			<td>Fisher Scientific</td>
			<td>SH30022FS</td>
			<td></td>
		</tr>
		<tr>
			<td>Fetal bovine serum</td>
			<td>Hyclone</td>
			<td>SH30071</td>
			<td></td>
		</tr>
		<tr>
			<td>Penicillin/Streptomycin</td>
			<td>Fisher Scientific</td>
			<td>MP091670049</td>
			<td></td>
		</tr>
		<tr>
			<td>PolyJet</td>
			<td>Fisher Scientific</td>
			<td>50-478-8</td>
			<td></td>
		</tr>
		<tr>
			<td>Protease inhibitor cocktail&#160;</td>
			<td>Roche&#160;</td>
			<td>11836153001</td>
			<td></td>
		</tr>
		<tr>
			<td>STREP-Tactin Superflow</td>
			<td>IBA</td>
			<td>2-1208-010</td>
			<td></td>
		</tr>
		<tr>
			<td>STREP-tag elution buffer</td>
			<td>IBA</td>
			<td>2-1000-025</td>
			<td></td>
		</tr>
		<tr>
			<td>EZview Red ANTI-FLAG M2 Affinity Gel</td>
			<td>Sigma</td>
			<td>SLBQ1981V</td>
			<td></td>
		</tr>
		<tr>
			<td>Corning 100mm &#215; 20 mm style Dish cell culture treated nonpyrogenic polystyrene 20/sleeve</td>
			<td>Corning&#160;</td>
			<td>430167</td>
			<td></td>
		</tr>
		<tr>
			<td>Protein Lo-Bind Eppendorf</td>
			<td>Fisher Scientific</td>
			<td>13-698-794</td>
			<td></td>
		</tr>
		<tr>
			<td>Digital Vortex Mixer</td>
			<td>Fisher Scientific&#160;</td>
			<td>02-215-370</td>
			<td></td>
		</tr>
		<tr>
			<td>48 hole micro tube foam rack</td>
			<td>Fisher Scientific</td>
			<td>02-215-386</td>
			<td></td>
		</tr>
		<tr>
			<td>Labquake shaker rotisserie&#160;</td>
			<td>Thermo&#160;</td>
			<td>415110</td>
			<td></td>
		</tr>
	</tbody>
</table>

tandem affinity purification of protein complexes from eukaryotic cells

Die Reinigung von aktivem Protein-Protein- und Protein-Nukleinsäure-Komplexen ist von entscheidender Bedeutung für die Charakterisierung der enzymatischen Aktivitäten und de novo Identifizierung neuer Untereinheiten und post-translationalen Modifikationen. Bakterielle Systeme erlauben die für die Expression und Reinigung einer Vielzahl von einzelnen Polypeptide und Proteinkomplexen. Allerdings ist dieses System nicht die Reinigung von Protein - Untereinheiten ermöglichen , die post-translationale Modifikationen beinhalten (zB Phosphorylierung und Acetylierung) und die Identifizierung von neuen regulatorischen Untereinheiten , die nur present / ausgedrückt in der eukaryotischen System sind. Hier stellen wir eine detaillierte Beschreibung eines neuen, robusten und effizienten tandem Affinitätsreinigung (TAP) Verfahren unter Verwendung von Strep- und FLAG-markierte Proteine, die die Reinigung von Proteinkomplexen mit transient oder stabil exprimiert erleichtert Epitop-markierten Proteinen aus eukaryontischen Zellen. Dieses Protokoll kann angewendet werden Prot zu charakterisierenein komplexer Funktionalität, zu entdecken, post-translationale Modifikationen an komplexen Untereinheiten und neuen Regulations komplexen Komponenten durch Massenspektrometrie zu identifizieren. Bemerkenswert ist, kann diese TAP-Methode angewendet werden Proteinkomplexe durch eukaryotische oder pathogene (viral und bakteriell) Komponenten gebildet zu untersuchen, so dass eine Vielzahl von stromabwärts experimentellen Möglichkeiten ergibt. Wir schlagen vor, dass die Forscher mit Proteinkomplexen arbeiten in vielen verschiedenen Möglichkeiten, um diesen Ansatz nutzen können.

In diesem Artikel zeigen wir die Anwendbarkeit der TAP Verfahren zur gut charakterisierten CycT1-CDK9 Komplexes (auch als P-TEFb Kinase bekannt). Plasmide , kodierend Cyclin T1-Strep (CycT1: S) und CDK9-FLAG (CDK9: F) oder CDK9-Strep (CDK9: S) und Cyclin T1-FLAG (CycT1: F) (Tabelle 1), wurden in HEK293T - Zellen transfiziert . Negative Kontrollen enthalten Transfektionen mit einem leeren Vektor und dem CDK9: F oder CycT1: F - Plasmide (3A und B, respectively). Die Proteine ​​wurden für 48 Stunden ausgedrückt, bevor die Zellen gesammelt wurden. Mehrere Platten von Zellen wurden pro Experiment verwendet (fünf Platten pro Probe für die Daten in Abbildung 3 dargestellt verwendet wurden) Protein - Produktion und Rückgewinnung zu erhöhen. Nachdem die Zellen in einzelnen Mikrozentrifugenröhrchen lysiert wurden, wurden die Zell-Lysate der gleichen Probe in einem microcentrif kombiniertenuge Rohr vor der STREP Perlen Zugabe. Die Proteinproben mit einem Teil der Perlen Kombination erhöht die endgültige Proteinkonzentration, die Proteingewinnung von Proteinen verbessern können, die schwer auszudrücken sind. Nach der anfänglichen Elution kann eine zweite Elution erfolgen, um die Gesamtprotein Eingang für das FLAG IP zu erhöhen. Es ist wichtig , den Eingang für jeden Reinigungsschritt zu speichern , bevor die Perlen für zukünftige Fehlerbehebung (Tabelle 2) Zugabe, falls erforderlich. Die Daten in 3A zeigt die Ergebnisse der TAP - Methode für CycT1: S und CDK9: F, durch Western - Blot analysiert. CDK9: F mit CycT1 co-eluiert: S aus den Strep-Perlen, aber nicht in der Negativkontrolle AP fehlt CycT1: S, was anzeigt, daß CDK9: F und CycT1: S ein komplexes Protein-Protein bilden. Expectedly wurden beide Proteine ​​in der FLAG Elution detektiert, wodurch die Komplexbildung bestätigt. 3B zeigt die results des reziproken TAP-Methode, wobei die Epitop-Tags der beiden Proteine ​​wurden vertauscht (CDK9: S und CycT1: F) und durch Western-Blot analysiert. 3C und 3D zeigen die Ergebnisse der TAP und gegenseitige TAP durch Silberfärbung analysiert sind. 3C Spur 2 zeigte , dass CDK9: F coeluierte mit CycT1: S aus der STREP Perlen, aber nicht von der Steuer AP (Spur 1), was darauf hinweist , dass CDK9: F und CycT1: S ein Protein-Protein - Komplex gebildet. In der anschließenden FLAG Elution, wie in Spur 4, CycT1 gezeigt: S coeluierte mit CDK9: F aus Perlen der Flagge. In ähnlicher Weise zeigte Figur 3D , dass CycT1: F coeluierte mit CDK9: S aus der STREP Perlen, aber nicht von der Steuer AP, und dass das Protein-Protein - Komplex wurde effizient nach dem zweiten FLAG IP Schritt zurückgewonnen. Sowohl die Western-Blots und Silberfärbung bestätigt, dass das TAP-Protokoll effizient für die purificatio gearbeitet<html> n, Isolierung und Charakterisierung des Proteinkomplexes von Interesse. <img alt="Abbildung 1" src="/files/ftp_upload/55236/55236fig1.jpg" /> Abbildung 1: Übersicht über die TAP Reinigungsstrategie. Ein einfaches Schema die Schritte TAP beschreibt. Plasmide, codierend das Protein von Interesse mit entweder dem STREP oder FLAG-Epitop-Tag sind co-transfiziert in Säugerzellen. Nach 48 h Induktion wurden die Zellen gesammelt und lysiert. Lösliche Zelllysat das Protein von Interesse zusammen mit anderen Proteinen enthalten, werden auf STREP Perlen geladen für STREP AP. Proteine, die entweder den Strep-Tag enthalten, oder werden dem Strep-tagged Protein gebunden an die Kügelchen gebunden sind, dann eluiert. Die FLAG Kügelchen wurden dann in die STREP Elution zugesetzt. Die Proteine, die entweder die FLAG-Tag enthalten oder an die FLAG-markierten Protein gebunden an die Kügelchen gebunden sind, dann eluiert. Elutionen konnte durch die angegebenen Methoden analysiert werden.ttp: //ecsource-jove-com.remotexs.ntu.edu.sg/files/ftp_upload/55236/55236fig1large.jpg &quot;target =&quot; _ blank &quot;&gt; Bitte hier klicken, um eine größere Version dieser Figur zu sehen. <img alt="Figur 2" src="/files/ftp_upload/55236/55236fig2.jpg" /> Abbildung 2: Schematische Darstellung der TAP - Strategie. Ein detailliertes Protokoll von TAP. Siehe Text für weitere Einzelheiten. <a href="https://ecsource-jove-com.remotexs.ntu.edu.sg/files/ftp_upload/55236/55236fig2large.jpg" target="_blank">Bitte klicken Sie hier</a> , um <a href="https://ecsource-jove-com.remotexs.ntu.edu.sg/files/ftp_upload/55236/55236fig2large.jpg" target="_blank">eine größere Version dieser Figur zu sehen.</a> <img alt="Figur 3" src="/files/ftp_upload/55236/55236fig3.jpg" /> Abbildung 3: Beispiel für Schritt- für -Schritt - Analyse von TAP Reinigung. (A) Western - Blot - Analyse von TAP (CycT1: S und CDK9: F). (B) Western - Blot - Analyse von reziproken TAP (CDK9: S und CycT1: F). from 1 ml Voll Zelllysat, 5 ul (0,2%) wurde als loaded &quot;STREP AP Input&quot;. 975 &amp; mgr; l der verbleibenden gesamte Zelllysat wurde für STREP AP zu STREP Kügelchen gegeben und 100 ul &quot;STREP AP Elution&quot; gesammelt wurde. Daraus 5 &amp; mgr; l (2%) geladen wurde. 80 ul der &quot;STREP AP Elution&quot; wurde für FLAG IP zu FLAG Kügelchen gegeben und 30 ul &quot;FLAG IP Elution&quot; gesammelt wurde. Von den 30 ul &quot;FLAG IP Elution&quot;, 7 ul (23,3%) wurde geladen. (C) Silberfärbungsanalyse von TAP (CycT1: S und CDK9: F). (D) Silberfärbungsanalyse von reziproken TAP (CDK9: S und CycT1: F). 5 ul (2%) von &quot;STREP AP Elution&quot; und 7 ul (23,3%) von &quot;FLAG IP Elution&quot; geladen wurden. Die Sternchen zeigen coeluierte Verunreinigungen. <a href="https://ecsource-jove-com.remotexs.ntu.edu.sg/files/ftp_upload/55236/55236fig3large.jpg" target="_blank">Bitte klicken Sie hier</a> , um <a href="https://ecsource-jove-com.remotexs.ntu.edu.sg/files/ftp_upload/55236/55236fig3large.jpg" target="_blank">eine größere Version dieser Figur zu sehen.</a> <table fo:keep-together.within-page = &quot;1&quot; fo: keep-mit-next.within-page = &quot;always&quot;&gt; <tbody><tr><td> Eiweiß </td><td> Rückstände </td><td> Vektor </td><td> Etikett </td><td> Klonierungsstellen </td><td> Referenz </td></tr><tr><td> CycT1 </td><td> 1-708 </td><td> pcDNA / 4TO </td><td> STREP </td><td> HindIII - EcoRI </td><td> McNamara et al. 2013 10 </td></tr><tr><td> CycT1 </td><td> 1-708 </td><td> pcDNA / 4TO </td><td> FLAGGE </td><td> HindIII - EcoRI </td><td> Dieser Artikel </td></tr><tr><td> CDK9 </td><td> 1-372 </td><td> pcDNA / 4TO </td><td> STREP </td><td> HindIII - XhoI </td><td> Dieser Artikel </td></tr><tr><td> CDK9 </td><td> 1-372 </td><td> pcDNA / 4TO </td><td> FLAG </td><td> HindIII - XhoI </td><td> McNamara et al., 2013 10 </td></tr><tr><td> GFP </td><td> 1-238 </td><td> pcDNA / 4TO </td><td> STREP-FLAG </td><td> BamHI - XhoI </td><td> Dieser Artikel </td></tr></tbody></table> Tabelle 1: Plasmide in dieser Studie verwendet. CycT1 und CDK9 wurden in die Plasmidvektoren pcDNA / 4TO-STREP und pcDNA / 4TO-FLAG ligiert. Diese Konstrukte wurden in DH5a kompetente Zellen transformiert und auf LB-Ampicillin-Platten. Kolonien wurden selektioniert, gezüchtet und gesiebt. Erfolgreich wurden ligiert Klone durch Sanger-Sequenzierung und der Kombination aus Restriktionsverdau und Agarose-Gelelektrophorese bestätigt. Für CycT1 verwendeten wir eine kürzere Version (1 - 708) anstelle der in voller Länge (1 - 726), da die letzten 18 Reste eines Schädlings-Sequenz (eine Peptidsequenz reich an enthaltenProlin, Glutaminsäure, Serin und Threonin), die für den Proteinabbau 20 als Signalpeptid fungiert. CDK9 war in voller Länge. Die Sequenz der Tandem-Strep-Tag ist wie folgt: GGGGWSHPQFEKGGGSGGGSGGGSWSHPQFEK. Die Sequenz der Tandem-FLAG-Tag ist wie folgt: GGGGDYKDHDGDYKDHDIDYKDDDDK. Tabelle 2: Tabelle zur Fehlerbehebung. Vor Beginn der bei der Fehlersuche, zu überprüfen stellen Sie sicher, dass jede wesentliche Schritt gefolgt wurde. Bestimmte Schritte in diesem Protokoll erfordern mehr als andere Optimierungs das erwartete Ergebnis zu erzielen. <a href="https://ecsource-jove-com.remotexs.ntu.edu.sg/files/ftp_upload/55236/Book2.xlsx">Bitte klicken Sie hier</a> , um <a href="https://ecsource-jove-com.remotexs.ntu.edu.sg/files/ftp_upload/55236/Book2.xlsx">diese Datei herunterzuladen.</a>

Watch this Scientific Journal Video about Tandem Affinity Purification of Protein Complexes from Eukaryotic Cells at JoVE.com

Tandem Affinity Purification of Protein Complexes from Eukaryotic Cells

We describe here a novel, robust, and efficient tandem affinity purification (TAP) method for the expression, isolation, and characterization of protein complexes from eukaryotic cells. This protocol could be utilized for the biochemical characterization of discrete complexes as well as the identification of novel interactors and post-translational modifications that regulate their function.

Tandem Affinity Purification von Proteinkomplexen aus eukaryotischen Zellen

The purification of active protein-protein and protein-nucleic acid complexes is crucial for the characterization of enzymatic activities and de novo ...

tandem-affinity-purification-protein-complexes-from-eukaryotic

Nanyang Technological University

Research

JoVE Journal

Biochemistry

14.8K Aufrufe.  The University of Texas Southwestern Medical Center. We describe here a novel, robust, and efficient tandem affinity purification (TAP) method for the expression, isolation, and characterization of protein complexes from eukaryotic cells. This protocol could be utilized for the biochemical characterization of discrete complexes as well as the identification of novel interactors and post-translational modifications that regulate their function.

Serie: Tandem Affinity Purification of Protein Complexes from Eukaryotic Cells

Isolation of Cognate RNA-protein Complexes from Cells Using Oligonucleotide-directed Elution

Ribonucleoprotein particles direct the biogenesis and post-transcriptional regulation of all mRNAs through distinct combinations of RNA binding proteins. They are composed of position-dependent, cis-acting RNA elements and unique combinations of RNA binding proteins. Defining the composition of a specific RNP is essential to achieving a fundamental understanding of gene regulation. The isolation of a select RNP is akin to finding a needle in a haystack. Here, we demonstrate an approach to isolate RNPs associated at the 5' untranslated region of a select mRNA in asynchronous, transfected cells. This cognate RNP has been demonstrated to be necessary for the translation of select viruses and cellular stress-response genes.
The demonstrated RNA-protein co-precipitation protocol is suitable for the downstream analysis of protein components through proteomic analyses, immunoblots, or suitable biochemical identification assays. This experimental protocol demonstrates that DHX9/RNA helicase A is enriched at the 5' terminus of cognate retroviral RNA and provides preliminary information for the identification of its association with cell stress-associated huR and junD cognate mRNAs.

This manuscript describes an approach to isolate select cognate RNPs formed in eukaryotic cells via a specific oligonucleotide-directed enrichment. We demonstrate the applicability of this approach by isolating a cognate RNP bound to the retroviral 5' untranslated region that is composed of DHX9/RNA helicase A.

Isolierung von Cognate RNA-Protein-Komplexe von Zellen unter Verwendung von Oligonukleotid-gerichtete Elution

Ribonucleoprotein particles direct the biogenesis and post-transcriptional regulation of all mRNAs through distinct combinations of RNA binding proteins. ...

Forschung

Biochemie

Protein Complex Affinity Capture from Cryomilled Mammalian Cells

Affinity capture is an effective technique for isolating endogenous protein complexes for further study. When used in conjunction with an antibody, this technique is also frequently referred to as immunoprecipitation. Affinity capture can be applied in a bench-scale and in a high-throughput context. When coupled with protein mass spectrometry, affinity capture has proven to be a workhorse of interactome analysis. Although there are potentially many ways to execute the numerous steps involved, the following protocols implement our favored methods. Two features are distinctive: the use of cryomilled cell powder to produce cell extracts, and antibody-coupled paramagnetic beads as the affinity medium. In many cases, we have obtained superior results to those obtained with more conventional affinity capture practices. Cryomilling avoids numerous problems associated with other forms of cell breakage. It provides efficient breakage of the material, while avoiding denaturation issues associated with heating or foaming. It retains the native protein concentration up to the point of extraction, mitigating macromolecular dissociation. It reduces the time extracted proteins spend in solution, limiting deleterious enzymatic activities, and it may reduce the non-specific adsorption of proteins by the affinity medium. Micron-scale magnetic affinity media have become more commonplace over the last several years, increasingly replacing the traditional agarose- and Sepharose-based media. Primary benefits of magnetic media include typically lower non-specific protein adsorption; no size exclusion limit because protein complex binding occurs on the bead surface rather than within pores; and ease of manipulation and handling using magnets.

Here we describe protocols to disrupt mammalian cells by solid-state milling at a cryogenic temperature, produce a cell extract from the resulting cell powder, and isolate protein complexes of interest by affinity capture upon antibody-coupled micron-scale paramagnetic beads.

Protein Complex Affinity Capture von Cryomilled Mammalian Cells

Affinity capture is an effective technique for isolating endogenous protein complexes for further study. When used in conjunction with an antibody, this ...

Resolving Affinity Purified Protein Complexes by Blue Native PAGE and Protein Correlation Profiling

Most proteins act in association with others; hence, it is crucial to characterize these functional units in order to fully understand biological processes. Affinity purification coupled to mass spectrometry (AP-MS) has become the method of choice for identifying protein-protein interactions. However, conventional AP-MS studies provide information on protein interactions, but the organizational information is lost. To address this issue, we developed a strategy to unravel the distinct functional assemblies a protein might be involved in, by resolving affinity-purified protein complexes prior to their characterization by mass spectrometry. Protein complexes isolated through affinity purification of a bait protein using an epitope tag and competitive elution are separated through blue native electrophoresis. Comparison of protein migration profiles through correlation profiling using quantitative mass spectrometry allows assignment of interacting proteins to distinct molecular entities. This method is able to resolve protein complexes of close molecular weights that might not be resolved by traditional chromatographic techniques such as gel filtration. With little more work than conventional AP-geLC-MS/MS, we demonstrate this strategy may in many cases be adequate for obtaining protein complex topological information concomitantly to identifying protein interactions.

Here we present protocols for affinity purification of protein complexes and their separation by blue native PAGE, followed by protein correlation profiling using label free quantitative mass spectrometry. This method is useful to resolve interactomes into distinct protein complexes.

Auflösen von Affinity Purified Protein-Komplexen von Blue native PAGE und Protein Correlation Profilieren

Most proteins act in association with others; hence, it is crucial to characterize these functional units in order to fully understand biological ...

2 in 1: One-step Affinity Purification for the Parallel Analysis of Protein-Protein and Protein-Metabolite Complexes

Cellular processes are regulated by interactions between biological molecules such as proteins, metabolites, and nucleic acids. While the investigation of protein-protein interactions (PPI) is no novelty, experimental approaches aiming to characterize endogenous protein-metabolite interactions (PMI) constitute a rather recent development. Herein, we present a protocol that allows simultaneous characterization of the PPI and PMI of a protein of choice, referred to as bait. Our protocol was optimized for Arabidopsis cell cultures and combines affinity purification (AP) with mass spectrometry (MS)-based protein and metabolite detection. In short, transgenic Arabidopsis lines, expressing bait protein fused to an affinity tag, are first lysed to obtain a native cellular extract. Anti-tag antibodies are used to pull down protein and metabolite partners of the bait protein. The affinity-purified complexes are extracted using a one-step methyl tert-butyl ether (MTBE)/methanol/water method. Whilst metabolites separate into either the polar or the hydrophobic phase, proteins can be found in the pellet. Both metabolites and proteins are then analyzed by ultra-performance liquid chromatography-mass spectrometry (UPLC-MS or UPLC-MS/MS). Empty-vector (EV) control lines are used to exclude false positives. The major advantage of our protocol is that it enables identification of protein and metabolite partners of a target protein in parallel in near-physiological conditions (cellular lysate). The presented method is straightforward, fast, and can be easily adapted to biological systems other than plant cell cultures.

Protein-protein and protein-metabolite interactions are crucial for all cellular functions. Herein, we describe a protocol that allows parallel analysis of these interactions with a protein of choice. Our protocol was optimized for plant cell cultures and combines affinity purification with mass spectrometry-based protein and metabolite detection.

2 in 1: Affinitätsreinigung für die parallele Analyse von Protein-Protein und Protein-Metabolit komplexe in einem Schritt

Cellular processes are regulated by interactions between biological molecules such as proteins, metabolites, and nucleic acids. While the investigation of ...

An Oligonucleotide-based Tandem RNA Isolation Procedure to Recover Eukaryotic mRNA-Protein Complexes

RNA-binding proteins (RBPs) play key roles in the post-transcriptional control of gene expression. Therefore, biochemical characterization of mRNA-protein complexes is essential to understanding mRNA regulation inferred by interacting proteins or non-coding RNAs. Herein, we describe a tandem RNA isolation procedure (TRIP) that enables the purification of endogenously formed mRNA-protein complexes from cellular extracts. The two-step protocol involves the isolation of polyadenylated mRNAs with antisense oligo(dT) beads and subsequent capture of an mRNA of interest with 3&#39;-biotinylated 2&#39;-O-methylated antisense RNA oligonucleotides, which can then be isolated with streptavidin beads. TRIP was used to recover in vivo crosslinked mRNA-ribonucleoprotein (mRNP) complexes from yeast, nematodes and human cells for further RNA and protein analysis. Thus, TRIP is a versatile approach that can be adapted to all types of polyadenylated RNAs across organisms to study the dynamic re-arrangement of mRNPs imposed by intracellular or environmental cues.

A tandem RNA isolation procedure (TRIP) for recovery of endogenously formed mRNA-protein complexes is described. Specifically, RNA-protein complexes are crosslinked in vivo, polyadenylated RNAs are isolated from extracts with oligo(dT) beads, and particular mRNAs are captured with modified RNA antisense oligonucleotides. Proteins bound to mRNAs are detected by immunoblot analysis.

Ein Oligonukleotid-basierte Tandem RNA Isolierung Vorgehensweise eukaryotischen mRNA-Protein-komplexe

RNA-binding proteins (RBPs) play key roles in the post-transcriptional control of gene expression. Therefore, biochemical characterization of mRNA-protein ...

Affinity Purification of Chloroplast Translocon Protein Complexes Using the TAP Tag

Chloroplast biogenesis requires the import of thousands of nucleus-encoded proteins into the plastid. The import of these proteins depends on the translocon at the outer (TOC) and inner (TIC) chloroplast membranes. The TOC and TIC complexes are multimeric and probably contain yet unknown components. One of the main goals in the field is to establish the complete inventory of TOC and TIC components. For the isolation of TOC-TIC complexes and the identification of new components, the preprotein receptor TOC159 has been modified N-terminally by the addition of the tandem affinity purification (TAP) tag resulting in TAP-TOC159. The TAP-tag is designed for two sequential affinity purification steps (hence "tandem affinity"). The TAP-tag used in these studies consists of a N-terminal IgG-binding domain derived from Staphylococcus aureus Protein A (ProtA) followed by a calmodulin-binding peptide (CBP). Between these two affinity tags, a tobacco etch virus (TEV) protease cleavage site has been included. Therefore, TEV protease can be used for gentle elution of TOC159-containing complexes after binding to IgG beads. In the protocol presented here, the second Calmodulin-affinity purification step was omitted. The purification protocol starts with the preparation and solubilization of total cellular membranes. After the detergent-treatment, the solubilized membrane proteins are incubated with IgG beads for the immunoisolation of TAP-TOC159-containing complexes. Upon binding and extensive washing, TAP-TOC159 containing complexes are cleaved and released from the IgG beads using the TEV protease whereby the S. aureus IgG-binding domain is removed. Western blotting of the isolated TOC159-containing complexes can be used to confirm the presence of known or suspected TOC and TIC proteins. More importantly, the TOC159-containing complexes have been used successfully to identify new components of the TOC and TIC complexes by mass spectrometry. The protocol that we present potentially allows the efficient isolation of any membrane-bound protein complex to be used for the identification of yet unknown components by mass spectrometry.

We here present a proven and tested protocol for the purification of chloroplast protein import complexes (TOC-TIC complex) using the TAP-tag. The one-step affinity-isolation protocol can potentially be applied to any protein and be used to identify new interaction partners by mass spectrometry.

Affinitätsreinigung der Chloroplasten Translocon Proteinkomplexe mit dem TAP-Tag

Chloroplast biogenesis requires the import of thousands of nucleus-encoded proteins into the plastid. The import of these proteins depends on the ...

Expression, Solubilization, and Purification of Eukaryotic Borate Transporters

The Solute Carrier 4 (SLC4) family of proteins is called the bicarbonate transporters and includes the archetypal protein Anion Exchanger 1 (AE1, also known as Band 3), the most abundant membrane protein in the red blood cells. The SLC4 family is homologous with borate transporters, which have been characterized in plants and fungi. It remains a significant technical challenge to express and purify membrane transport proteins to homogeneity in quantities suitable for&#160;structural or functional studies. Here we describe detailed procedures for the overexpression of borate transporters in Saccharomyces cerevisiae, isolation of yeast membranes, solubilization of protein by detergent, and purification of borate transporter homologs from S. cerevisiae, Arabidopsis thaliana, and Oryza sativa. We also detail a glutaraldehyde cross-linking experiment to assay multimerization of homomeric transporters. Our generalized procedures can be applied to all three proteins and have been optimized for efficacy. Many of the strategies developed here can be utilized for the study of other challenging membrane proteins.

Here we present a protocol to express, solubilize, and purify several eukaryotic borate transporters with homology to the SLC4 transporter family using yeast. We also describe a chemical cross-linking assay to assess the purified homomeric proteins for multimeric assembly. These protocols can be adapted for other challenging membrane proteins.

Ausdruck, Solubilisierung und Reinigung der eukaryotischen Borat-Transporter

The Solute Carrier 4 (SLC4) family of proteins is called the bicarbonate transporters and includes the archetypal protein Anion Exchanger 1 (AE1, also ...

Translating Ribosome Affinity Purification (TRAP) for RNA Isolation from Endothelial Cells In Vivo

Many studies have been limited to using in vitro cellular assays and whole tissues or isolating of specific cell types from animals for in vitro analysis of transcriptome and gene expression by qPCR and RNA sequencing. Comprehensive transcriptome and gene expression analysis of specific cell types in complex tissues and organs will be critical to understand cellular and molecular mechanisms by which genes are regulated and their association with tissue homeostasis and organ functions. In this article, we demonstrate the methodology for isolation of ribosome-bound RNA directly in vivo in the vascular endothelia of animal lungs as an example. The specific materials and procedures for tissue processing and RNA purification will be described, including the assessment of RNA quality and yield as well as real time qPCR for arteriogenic gene assays. This approach, known as translating ribosome affinity purification (TRAP) technique, can be utilized for characterization of gene expression and transcriptome analysis of certain cell types directly in vivo in any specific type in complex tissues.

Translating Ribosome Affinity Purification TRAP for RNA Isolation from Endothelial Cells In Vivo

We present an approach to purify ribosome-bound mRNA from vascular endothelial cells (ECs) directly in mouse brain, lung and heart tissues via EC-specific genetic tag of enhanced green fluorescence protein (EGFP)in ribosomes in combination with RNA purification.

Übersetzen von Ribososomen-Affinitätsreinigung (TRAP) zur RNA-Isolierung von Endothelzellen In vivo

Many studies have been limited to using in vitro cellular assays and whole tissues or isolating of specific cell types from animals for in vitro analysis ...

Bacterial Expression and Purification of Human Matrix Metalloproteinase-3 using Affinity Chromatography

Matrix metalloproteinases (MMPs) belong to the family of metzincin proteases with central roles in extracellular matrix (ECM) degradation and remodeling, as well as interactions with several growth factors and cytokines. Overexpression of specific MMPs is responsible in several diseases such as cancer, neurodegenerative diseases, and cardiovascular disease. MMPs have been the center of attention recently as targets to develop therapeutics that can treat diseases correlated to MMP overexpression.
To study the MMP mechanism in solution, more facile and robust recombinant protein expression and purification methods are needed for the production of active, soluble MMPs. However, the catalytic domain of most MMPs cannot be expressed in Escherichia coli (E. coli) in soluble form due to lack of posttranslational machinery, whereas mammalian expression systems are usually costly and have lower yields. MMP inclusion bodies must undergo the tedious and laborious process of extensive purification and refolding, significantly reducing the yield of MMPs in native conformation. This paper presents a protocol using Rosetta2(DE3)pLysS (hereafter referred to as R2DP) cells to produce matrix metalloproteinase-3 catalytic domain (MMP-3cd), which contains an N-terminal His-tag followed by pro-domain (Hisx6-pro-MMP-3cd) for use in affinity purification. R2DP cells enhance the expression of eukaryotic proteins through a chloramphenicol-resistant plasmid containing codons normally rare in bacterial expression systems. Compared to the traditional cell line of choice for recombinant protein expression, BL21(DE3), purification using this new strain improved the yield of purified Hisx6-pro-MMP-3cd. Upon activation and desalting, the pro domain is cleaved along with the N-terminal His-tag, providing active MMP-3cd for immediate use in countless in vitro applications. This method does not require expensive equipment or complex fusion proteins and describes rapid production of recombinant human MMPs in bacteria.

His-tag purification, dialysis, and activation are employed to increase yields of soluble, active matrix metalloproteinase-3 catalytic domain protein expression in bacteria. Protein fractions are analyzed via SDS-PAGE gels.

Bakterielle Expression und Aufreinigung der humanen Matrix-Metalloproteinase-3 mittels Affinitätschromatographie

Matrix metalloproteinases (MMPs) belong to the family of metzincin proteases with central roles in extracellular matrix (ECM) degradation and remodeling, ...

Extraction and Purification of FAHD1 Protein from Swine Kidney and Mouse Liver

Fumarylacetoacetate hydrolase domain-containing protein 1 (FAHD1) is the first identified member of the FAH superfamily in eukaryotes, acting as oxaloacetate decarboxylase in mitochondria. This article presents a series of methods for the extraction and purification of FAHD1 from swine kidney and mouse liver. Covered methods are ionic exchange chromatography with fast protein liquid chromatography (FPLC), preparative and analytical gel filtration with FPLC, and proteomic approaches. After total protein extraction, ammonium sulfate precipitation and ionic exchange chromatography were explored, and FAHD1 was extracted via a sequential strategy using ionic exchange and size-exclusion chromatography. This representative approach may be adapted to other proteins of interest (expressed at significant levels) and modified for other tissues. Purified protein from tissue may support the development of high-quality antibodies, and/or potent and specific pharmacological inhibitors.

This protocol describes how to extract fumarylacetoacetate hydrolase domain-containing protein 1 (FAHD1) from swine kidney and mouse liver. The listed methods may be adapted to other proteins of interest and modified for other tissues.