Research reported in this publication was supported by the National Institute of Allergy and Infectious Diseases (NIAID) of the NIH under award number R01AI114362 and Welch Foundation grant I-1782 to Iv&#225;n D'Orso.

1. Cellule placcatura <ol><li> Un giorno prima della trasfezione, piastra di 3,5 x 10 6 cellule HEK293T in 10 mL di Dulbecco Modified Eagle Medium (DMEM) supplementato con 10% (v / v) di siero fetale bovino (FBS) e 1% (v / v) di penicillina / streptomicina (10.000 U / ml magazzino) per ogni piatto a 100 mm. Tavola 3 - 5 100 piatti mm per esperimento / condizione per garantire il recupero di proteine ​​sufficiente. NOTA: Il numero di lastre deve essere determinato per ogni esperimento / condizione, che si baserà sui livelli di espressione e la solubilità del complesso proteina di interesse. In alternativa, se è necessaria la purificazione scala ingrandita, linee cellulari possono essere adattati a crescere in sospensione in fiaschi filatore 2, ma questo metodo non funziona per trasfezioni transitorie. </li></ol> 2. transfecting cellule o indurre linee cellulari stabili <ol><li> Il giorno seguente, controllare le cellule sotto il microscopio. Le cellule devono essere 70 - 80% confluenti prima proceEding. </li><li> Trasfezione delle cellule con una miscela totale di 7 mg di DNA plasmidico e 21 ml di reagente per trasfezione piatto a 100 mm. Cellule trasfezione con un vettore che esprime GFP (Tabella 1) come controllo per l&#39;efficienza di trasfezione. NOTA: Se si utilizza un HEK293-T-Rex o simile linea cellulare stabile che induce l&#39;espressione di due o più complessi subunità in risposta alla doxiciclina 14, 15, l&#39;induttore dovrà essere aggiunto alle cellule e incubate per 48 ore. Analogamente, una linea cellulare stabile che induce l&#39;espressione di GFP dopo l&#39;aggiunta del induttore sarebbe necessaria anche per scopi di convalida. Passare al punto 2.7. </li><li> Preparare la miscela di trasfezione per ogni piatto a 100 mm. In una provetta da 1,5 ml microcentrifuga, miscelare 500 ml di DMEM senza supplementi con 7 mg di DNA plasmidico totale (corrispondente a due o più plasmidi). In una provetta separata, mescolare 500 ml di DMEM senza supplementi with 21 ml di reagente di trasfezione. Ripetere l&#39;operazione per ogni reazione trasfezione. </li><li> Pipetta la soluzione di trasfezione del reagente nella soluzione plasmide DNA (non mescolare soluzioni in ordine inverso). Mescolare pipettando almeno 4 volte. </li><li> Incubare la miscela a temperatura ambiente per 10 - 15 min, ma non più di 15 min. </li><li> La piastra per creare un serbatoio media e accuratamente pipetta la miscela di trasfezione goccia a goccia sul lato interno della piastra senza disturbare le cellule. Riportare il piatto nella posizione piatta originale e miscelare delicatamente per distribuire il composto. </li><li> Incubare le cellule a 37 ° C in un incubatore umidificato coltura cellulare con 5% di CO 2 (questa condizione è seguito indicato come &quot;coltura tissutale incubatore&quot;). Sostituire i media 5 ore dopo la trasfezione (opzionale). </li></ol> 3. Controllo Transfection o induzione efficienza <ol><li> A 24 ore dopo la trasfezione, visualizzare le cellule in una influenzaMicroscopio orescent per verificare l&#39;efficienza di trasfezione (o induzione di controllo HEK293T-Rex linea cellulare stabile che esprimono GFP). Incubare per altre 24 ore. </li></ol> 4. STREP Affinity Purification (STREP AP) <ol><li> Raccogliere le cellule <ol><li> A 48 ore dopo la trasfezione, rimuovere il supporto e aggiungere 8 ml di soluzione fisiologica fredda 1x tampone fosfato (PBS). Pipettare su e giù per staccare le cellule dalla piastra. </li><li> Raccogliere e trasferire la sospensione cellulare in una provetta da 15 ml e girare le celle in basso a 800 xg per 4 minuti a 4 ° C. </li><li> Rimuovere il surnatante PBS. Ripetere la rotazione verso il basso (800 xg per 1 min a 4 ° C) per eliminare eventuali residui di PBS. Conservare il pellet a -80 ° C per un uso futuro o seguire la procedura qui sotto per continuare purificazione della proteina. </li></ol></li><li> Lisi delle cellule <ol><li> Risospendere il pellet di cellule utilizzando 5 × volume pellet cellulare (~ 250 microlitri per piastra) di Passive Lysis Buffer(PLB: 20 mM Tris-HCl pH 7,5, 150 mM NaCl, 1,5 mM MgCl 2, 1 mM DTT, proteasi tablet inibitore cocktail, 5% v / v di glicerolo, e 1,0% NP-40) e trasferire la sospensione cellulare in un 1,5 ml provetta. </li><li> Brevemente vortice sospensione e nutate per 30 minuti a 4 ° C. </li><li> Centrifugare la sospensione cellulare a 10.000 xg per 10 min a 4 ° C. </li><li> Trasferire i lisati solubili in una nuova provetta da 1,5 ml e scartare il pellet di cellule. Risparmi 10% del volume finale del lisato solubile &quot;STREP AP Input.&quot; Conservare a 4 ° C. </li></ol></li><li> Equilibrando le perline STREP NOTA: Utilizzare STREP perline per il primo passo di AP! Complessi tirato giù con perline STREP recuperare significativamente più proteine ​​di quelle abbattute con perline FLAG. <ol><li> Estrarre (n × 40 ml) + n ml di STREP tallone slurry 50% (n = numero di campioni) e spin down a 1.500 xg per 2 minuti a 4 ° C. NOTA: utilizzare in tutto il mpunte outhed a perline pipetta. </li><li> Rimuovere il surnatante e aggiungere 500 ml di PLB ai talloni. Nutate la miscela perline per 5 minuti a 4 ° C. Spin down a 1.500 xg per 2 minuti a 4 ° C. <ol><li> Ripetere per un totale di 3 lavaggi. Risospendere le sfere in PLB ad un volume finale di n × 40 microlitri. </li></ol></li><li> Aggiungere 40 ml di 50% STREP tallone slurry per ogni campione lisato cellulare e nutate per 2 ore a 4 ° C. </li></ol></li><li> STREP AP <ol><li> Spin down soluzione a 1.500 xg per 2 minuti a 4 ° C. </li><li> Rimuovere il surnatante e conservare come &quot;STREP AP flusso-through (FT)&quot; a 4 ° C. </li><li> Aggiungere 500 pl di STREP AP Wash Buffer I (20 mM Tris-HCl pH 7,5, 250 mM NaCl, 1,5 mM MgCl 2, 1 mM DTT, 5% glicerolo e 0,2% NP-40) ai talloni. Nutate la miscela perline per 5 minuti a 4 ° C e centrifugare a 1500 xg per 2 minuti a 4 ° C. Eliminare il surnatante. <ol><li> Ripetere per un totale di 4 lavaggi. <br/&gt; NOTA: Prima quarto lavaggio, trasferire la soluzione perline in una nuova provetta da 1,5 ml ridurre lo sfondo proteine. Questo passaggio è fondamentale. </li></ol></li><li> Aggiungere 500 microlitri di tampone di lavaggio II (100 mM Tris-HCl pH 8,0, 150 mM NaCl, e 1 mM EDTA) ed equilibrare le perline invertendo i tubi. Spin down a 1.500 xg per 2 minuti a 4 ° C e scartare il surnatante. </li><li> Eluire la proteina di interesse con 50 ml di tampone di eluizione STREP (100 mM Tris-HCl pH 8,0, 150 mM NaCl, 1 mM EDTA e 2,5 mM Desthiobiotin). Vortex a 800 rpm per 15 min a 4 ° C. </li><li> Spin giù le perline a 1.500 xg per 1 min a 4 ° C. Raccogliere il surnatante. Tale quota corrisponde al campione &quot;STREP AP Elution&quot;. </li><li> Salvare la frazione perline a 4 ° C per una seconda eluizione, che potrebbe produrre fino a metà della quantità di proteina ottenuta con la prima eluizione. Aliquotare 10% del STREP AP Elution per la colorazione argento e / o western blotting16. </li></ol></li><li> Equilibrando le perline FLAG <ol><li> Estrarre (nx 16 ml) + n ml di soluzione di FLAG perline (n = numero di campioni) e spin down a 1.500 xg per 2 minuti a 4 ° C. NOTA: utilizzare punte bocca larga per perline pipetta. </li><li> Rimuovere il surnatante e aggiungere 500 ml di tampone di lavaggio FLAG (100 mM Tris-HCl pH 8,0, 150 mM NaCl, 1 mM EDTA e 0,1% NP-40) ai talloni. Spin down a 1.500 xg per 2 minuti a 4 ° C. Ripetere per un totale di 3 lavaggi. </li><li> Risospendere le sfere in tampone di lavaggio FLAG ad un volume finale di nx 16 ml. </li><li> Aggiungere 16 ml di liquame FLAG tallone per il restante eluizione STREP AP e pernottamento nutate a 4 ° C. </li></ol></li></ol> 5. FLAG IP <ol><li> Spin giù la sospensione perline FLAG a 1.500 xg per 2 minuti a 4 ° C. Salvare il surnatante e conservare come la &quot;FLAG IP Flow-through&quot; (FT) a 4 ° C. </li><li> Aggiungere 50081; l di tampone di lavaggio FLAG alla soluzione. Nutate per 5 minuti a 4 ° C e centrifugare a 1500 xg per 2 minuti a 4 ° C. Ripetere per un totale di 4 lavaggi e rimuovere il surnatante dopo ogni lavaggio. NOTA: prima il quarto lavaggio, trasferire la soluzione proteica-perline in una nuova provetta da 1,5 ml per ridurre sfondo. Questo passaggio è fondamentale. </li><li> Rimuovere il surnatante dalla centrifuga finale e aggiungere 30 ml di tampone di lavaggio FLAG contenente 200 ng / ml di FLAG peptide nelle perline. Vortex a 800 rpm per 2 ore a 4 ° C. </li><li> Centrifugare la sospensione a 1.500 xg per 2 minuti a 4 ° C. Raccogliere il surnatante e conservare a 4 ° C come la &quot;FLAG IP eluizione.&quot; NOTA: I campioni di eluizione possono essere confermate con macchia d&#39;argento e / o Western Blot utilizzando protocolli standard di 16, e sono pronti per ulteriori analisi di proteine. Quando si imposta un Western Blot, eseguire tutti i seguenti campioni: (1) STREP AP Ingresso, (2) STREP AP FT, (3) STREP AP Elutisu, (4) FLAG IP FT, e (5) bandiera IP eluizione. I volumi caricati dovranno essere determinati per ogni esperimento. Tutti i campioni raccolti e perline possono essere conservati a 4 ° C per una conservazione a breve termine e a -80 ° C per una conservazione a lungo termine. Campioni TAP possono essere analizzati mediante spettrometria di massa per verificare l&#39;identità dei loro componenti, per identificare nuove modificazioni post-traduzionali (PTM), e / o per scoprire ogni interazione proteina romanzo con il complesso purificato 2, 17. A tale scopo, dopo l&#39;esecuzione di un gel Coomassie o argento macchia, bande possono essere tagliate dal gel utilizzando un bisturi pulito. Diversi ottime recensioni che discutono i metodi di spettrometria di massa sono stati pubblicati in precedenza 18, 19. </li></ol>

<ol>
	<li>Sharan, R., Ulitsky, I., Shamir, R. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Network-based+prediction+of+protein+function.">Network-based prediction of protein function.</a> Mol Syst Biol. 3, 88-99 (2007).</li><li>Jager, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Global+landscape+of+HIV-human+protein+complexes.">Global landscape of HIV-human protein complexes.</a> Nature. 481, 365-370 (2012).</li><li>Fields, S., Song, O. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+novel+genetic+system+to+detect+protein-protein+interactions.">A novel genetic system to detect protein-protein interactions.</a> Nature. 340, 245-246 (1989).</li><li>Luo, Y., Batalao, A., Zhou, H., Zhu, L. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Mammalian+two-hybrid+system:+a+complementary+approach+to+the+yeast+two-hybrid+system.">Mammalian two-hybrid system: a complementary approach to the yeast two-hybrid system.</a> Biotechniques. 22, 350-352 (1997).</li><li>Lee, C. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Coimmunoprecipitation+assay.">Coimmunoprecipitation assay.</a> Methods Mol Biol. 362, 401-406 (2007).</li><li>Puig, O., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+tandem+affinity+purification+(TAP)+method:+a+general+procedure+of+protein+complex+purification.">The tandem affinity purification (TAP) method: a general procedure of protein complex purification.</a> Methods. 24, 218-229 (2001).</li><li>Jager, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Purification+and+characterization+of+HIV-human+protein+complexes.">Purification and characterization of HIV-human protein complexes.</a> Methods. 53, 13-19 (2011).</li><li>Price, D. H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=P-TEFb,+a+cyclin-dependent+kinase+controlling+elongation+by+RNA+polymerase+II.">P-TEFb, a cyclin-dependent kinase controlling elongation by RNA polymerase II.</a> Mol Cell Biol. 20, 2629-2634 (2000).</li><li>Peterlin, B. M., Price, D. H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Controlling+the+elongation+phase+of+transcription+with+P-TEFb.">Controlling the elongation phase of transcription with P-TEFb.</a> Mol Cell. 23, 297-305 (2006).</li><li>McNamara, R. P., McCann, J. L., Gudipaty, S. A., D'Orso, I. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Transcription+factors+mediate+the+enzymatic+disassembly+of+promoter-bound+7SK+snRNP+to+locally+recruit+P-TEFb+for+transcription+elongation.">Transcription factors mediate the enzymatic disassembly of promoter-bound 7SK snRNP to locally recruit P-TEFb for transcription elongation.</a> Cell Rep. 5, 1256-1268 (2013).</li><li>Adelman, K., Lis, J. T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Promoter-proximal+pausing+of+RNA+polymerase+II:+emerging+roles+in+metazoans.">Promoter-proximal pausing of RNA polymerase II: emerging roles in metazoans.</a> Nat Rev Genet. 13, 720-731 (2012).</li><li>D'Orso, I. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=7SKiing+on+chromatin:+move+globally,+act+locally.">7SKiing on chromatin: move globally, act locally.</a> RNA Biol. 13, 545-553 (2016).</li><li>McNamara, R. P., Bacon, C. W., D'Orso, I. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Transcription+Elongation+Control+by+the+7SK+snRNP+Complex:+Releasing+the+Pause.">Transcription Elongation Control by the 7SK snRNP Complex: Releasing the Pause.</a> Cell Cycle. 15, 2115-2123 (2016).</li><li>Yao, F., Svensjo, T., Winkler, T., Lu, M., Eriksson, C., Eriksson, E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Tetracycline+repressor,+tetR,+rather+than+the+tetR-mammalian+cell+transcription+factor+fusion+derivatives,+regulates+inducible+gene+expression+in+mammalian+cells.">Tetracycline repressor, tetR, rather than the tetR-mammalian cell transcription factor fusion derivatives, regulates inducible gene expression in mammalian cells.</a> Hum Gene Ther. 9, 1939-1950 (1998).</li><li>McNamara, R. P., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=KAP1+Recruitment+of+the+7SK+snRNP+Complex+to+Promoters+Enables+Transcription+Elongation+by+RNA+Polymerase+II.">KAP1 Recruitment of the 7SK snRNP Complex to Promoters Enables Transcription Elongation by RNA Polymerase II.</a> Mol Cell. 61, 39-53 (2016).</li><li>Ausubel, F. M., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=.">.</a> Current Protocols in Molecular Biology. , (1994).</li><li>Trudgian, D. C., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Comparative+evaluation+of+label-free+SINQ+normalized+spectral+index+quantitation+in+the+central+proteomics+facilities+pipeline.">Comparative evaluation of label-free SINQ normalized spectral index quantitation in the central proteomics facilities pipeline.</a> Proteomics. 11, 2790-2797 (2011).</li><li>Choudhary, C., Mann, M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Decoding+signalling+networks+by+mass+spectrometry-based+proteomics.">Decoding signalling networks by mass spectrometry-based proteomics.</a> Nat Rev Mol Cell Biol. 11, 427-439 (2010).</li><li>Bensimon, A., Heck, A. J., Aebersold, R. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Mass+spectrometry-based+proteomics+and+network+biology.">Mass spectrometry-based proteomics and network biology.</a> Annu Rev Biochem. 81, 379-405 (2012).</li><li>Rogers, S., Wells, R., Rechsteiner, M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Amino+acid+sequences+common+to+rapidly+degraded+proteins:+the+PEST+hypothesis.">Amino acid sequences common to rapidly degraded proteins: the PEST hypothesis.</a> Science. 234, 364-368 (1986).</li></ol>

The authors have nothing to disclose.

Il protocollo qui descritto per l&#39;espressione e l&#39;isolamento di complessi proteici da cellule eucariotiche non è limitata alla caratterizzazione biochimica di tali complessi molecolari, ma può anche essere utilizzato per l&#39;identificazione di nuovi interattori e modificazioni post-traduzionali che potrebbe regolare la loro funzione. L&#39;utilizzo di tag di affinità non si limita a ciò che è menzionato in questo protocollo; ma la nostra esperienza suggerisce che l&#39;utilizzo STREP come primo passo AP migliora significativamente la resa del complesso proteina-proteina finale. Entrambi i punti di legame e di eluizione da e per le perle STREP sono estremamente efficienti rispetto ad altri tag epitopi (ad esempio, la bandiera). Inoltre, in teoria, TAP potrebbe essere applicata ad altre proteine o domini con alcune ottimizzazioni minori, come condizioni di buffer, il numero di piastre per esperimento (per entrambi i sistemi esprimono transienti e stabili), ecc Inoltre, il metodo TAP può anche essere applicata to altre linee cellulari se specifiche proteine ​​complessi richiedono un sistema speciale per la loro funzione o il loro interazioni con i fattori unici. Per facilitare la risoluzione dei problemi, si raccomanda che i campioni di ingresso e FT entrambi essere salvati (Tabella 2). Quando le bande proteiche previsti non possono essere visualizzati nel eluizione, i campioni FT possono essere utilizzati per risolvere l&#39;esperimento e determinare se il campione aveva legato e / o eluito off delle perline. Un TAP successo è strettamente dipendente alti livelli di espressione della proteina e recupero. Così, i ricercatori dovrebbero ottimizzare la quantità di materiale di partenza, caso per caso. Se trasfezione transiente viene usato per esprimere componenti proteiche, l&#39;efficienza di trasfezione dovrebbe essere almeno del 70% prima di procedere alla seconda fase del TAP. Il metodo TAP reciproco (in cui gli epitopi sono scambiati tra le due esche) di solito aiuta a determinare quale strategia sperimentaledovrebbe essere utilizzato per ottenere la migliore purezza e resa. Di nuovo, questo dovrà essere esaminati caso per caso. È importante sottolineare che, eseguendo TAP reciproca conferma che il PPI è indipendente dal tag di affinità utilizzato. Alcuni aspetti del metodo TAP presentati sono qui limitazioni. Ad esempio, l&#39;iperespressione della bandierina e le proteine ​​STREP-tag potrebbe generare artefatti per la stessa proteina ectopicamente espressa o dei loro interattori. Tag diversi epitopi possono influenzare i livelli di espressione della proteina, la conformazione delle proteine ​​e / o localizzazione subcellulare. Oltre alla limitazione linea cellulare e l&#39;efficienza di trasfezione, le dimensioni dei complessi da depurare potrebbe essere un problema. Questo metodo funziona bene per TAP complessi proteici multi-subunità. Dalla nostra esperienza, quattro componenti possono essere rilevate da macchia d&#39;argento (dati non mostrati). Tuttavia, quando si utilizza componenti a due targhette, gli altri interattori non possono essere co-purificato a livelli stechiometrici identici. Perciò,per questo particolare obiettivo, si consiglia l&#39;uso di linee cellulari che induce bassi livelli di espressione dei componenti complessi. Un&#39;altra limitazione sarebbe la forza del PPI. Se le interazioni non sono sufficientemente stabili, alcuni componenti potrebbero essere persi durante le fasi di purificazione (soprattutto nella fase finale IP FLAG). Il metodo TAP è stato precedentemente descritto e diversi tag epitopi diversi sono stati testati, validati, e confrontato 6. Tuttavia, il metodo TAP presentato in questo articolo è nuovo e fornisce una strategia semplice, efficace, affidabile e un&#39;alternativa per studiare IPP, assieme complesso, e dedurre la composizione rete proteica e funzione. Rispetto ai metodi TAP precedenti, questa strategia TAP STREP-FLAG permette la rapida purificazione di complessi per un&#39;ulteriore caratterizzazione senza una preventiva conoscenza della composizione complessa, attività o funzione; e senza la necessità di proteasi clivaggio (ad esempio, TEV) per eluizione della proteina (which può ridurre in modo significativo la resa di proteine). A causa della maggiore proteina complessa recupero, il metodo TAP STREP-FLAG permette anche l&#39;identificazione robusta di proteine che si associano con il complesso proteina di interesse in cellule mediante analisi di spettrometria di massa tandem 10, 15. Successivamente, altri metodi, come la microscopia confocale, cromatografia ad esclusione sterica, e saggi di co-IP, possono anche essere utilizzati per convalidare i PPI. Infine, proponiamo che una versione alternativa del protocollo TAP potrebbe essere adattato per purificare e studiare l&#39;assemblaggio di discrete complessi proteina-RNA, che tremendamente aiutare i ricercatori nel campo della biologia RNA. In sintesi, vi presentiamo un metodo per purificare e caratterizzare i PPI in linee cellulari di mammifero. Proponiamo che questo metodo pone le basi per il futuro caratterizzazione e analisi funzionale di molti nuovi complessi proteici.

<html> Interazioni proteina-proteina (PPI) sono fondamentali per la precisa regolazione dei processi biologici 1, e ulteriori studi su questi inibitori della pompa protonica può dare informazioni relative la loro funzione 2. Diversi approcci sono stati ideati per lo studio e la caratterizzazione di IPP e per l&#39;identificazione de novo di nuove componenti proteici normativi. Nel 1989, Stanley Campi e colleghi hanno riportato il lievito doppio ibrido (Y2H) test 3. Questo approccio consente l&#39;identificazione imparziale e completa di interattori (prede) per una proteina definito di interesse (esche) in Saccharomyces cerevisiae. Oltre alla sua notevole utilità per scoprire IPP, il saggio Y2H può essere utilizzato per caratterizzare coppie di proteine ​​in cellule di lievito, definendo domini interagenti minime, e identificare mutazioni che aboliscono tali interazioni. Modificando il test Y2H, inibitori della pompa protonica può anche essere studiata in cellule di mammiferoclass = &quot;xref&quot;&gt; 4. Variazioni del dosaggio Y2H (ad esempio, il sistema di lievito tre ibrido) possono essere applicate anche a studiare proteina-RNA e proteina-piccola interazioni legante organico nelle cellule. Un altro strumento comunemente utilizzato per studiare PPI in un sistema omologo è il test 5 co-immunoprecipitazione (co-IP). Utilizzando un anticorpo per immunoprecipitare una proteina di interesse, il test di co-IP permette ai ricercatori di monitorare PPI nelle celle per diverse condizioni ambientali e situazioni sperimentali. L&#39;uso di proteine epitopi-tag (ad esempio, la bandiera, Myc, STREP, e HA, tra gli altri) in purificazione di affinità (AP) metodi ha facilitato l&#39;isolamento di proteine da miscele complesse di proteine per diversi saggi a valle, tra cui Western Blot, macchia d&#39;argento , e l&#39;analisi enzimatica. Tuttavia, nessuno di questi approcci precedenti consentire l&#39;isolamento di grandi quantità di complessi proteici per un&#39;ulteriore caratterizzazione compreso in vitro unssays, scoperta di subunità regolatorie mediante spettrometria di massa, e l&#39;identificazione di modificazioni post-traslazionali. Una versione migliorata del metodo AP viene chiamato Tandem AP (TAP), che è una tecnica di purificazione per studiare IPP creando una proteina di fusione con due epitopi che viene purificato mediante due AP successive 6, 7. In questo articolo, vi presentiamo una variante del metodo TAP per purificare complessi proteici in cui due subunità sono contrassegnati con diversi epitopi e poi purificato attraverso due punti di accesso sequenziali (STREP AP seguiti da FLAG IP). In primo luogo abbiamo a disposizione una panoramica minimalista di TAP (figura 1) e poi una descrizione dettagliata di tutte le fasi sperimentali (figura 2), in modo che i ricercatori li possono applicare alla loro complesso proteina di interesse. Per dimostrare l&#39;applicabilità del metodo di TAP, abbiamo scelto un ben caratterizzato ciclina-CDK complesso (di seguito PTEFB chinasi), che è composto della ciclina T1 subunità regolatrice (CycT1) e una chinasi (CDK9), ed è coinvolto nella regolazione della trascrizione di RNA polimerasi II (Pol II) 8, 9, 10. P-TEFb fosforila il dominio C-terminale di Pol II e dei suoi fattori di allungamento negativi associati, che allevia la pausa trascrizionale al promotore e facilita in tal modo la trascrizione allungamento 11, 12, 13. Con questa interazione conosciuta in mente, STREP-tag CycT1 e CDK9 FLAG-tag sono stati oltre espresso in cellule HEK293T. Un esperimento TAP reciproca è stata eseguita con CDK9 STREP-tag e FLAG-tagged CycT1 per convalidare ulteriormente che l&#39;interazione proteina è indipendente dalle epitopi utilizzati. Le cellule sono state raccolte e lisate 48 ore dopo la trasfezione. Il lisato solubile è stato purificato dalla TAP (STREP AP seguito da FLAGIP). Input e proteine purificate sono state analizzate mediante western blot e macchia d&#39;argento (Figura 3).

<table border="1" fo:keep-together.within-page="1" fo:keep-with-next.within-page="always">
	<tbody>
		<tr>
			<td>Dulbecco&#39;s Modified Eagle Medium (DMEM)</td>
			<td>Fisher Scientific</td>
			<td>SH30022FS</td>
			<td></td>
		</tr>
		<tr>
			<td>Fetal bovine serum</td>
			<td>Hyclone</td>
			<td>SH30071</td>
			<td></td>
		</tr>
		<tr>
			<td>Penicillin/Streptomycin</td>
			<td>Fisher Scientific</td>
			<td>MP091670049</td>
			<td></td>
		</tr>
		<tr>
			<td>PolyJet</td>
			<td>Fisher Scientific</td>
			<td>50-478-8</td>
			<td></td>
		</tr>
		<tr>
			<td>Protease inhibitor cocktail&#160;</td>
			<td>Roche&#160;</td>
			<td>11836153001</td>
			<td></td>
		</tr>
		<tr>
			<td>STREP-Tactin Superflow</td>
			<td>IBA</td>
			<td>2-1208-010</td>
			<td></td>
		</tr>
		<tr>
			<td>STREP-tag elution buffer</td>
			<td>IBA</td>
			<td>2-1000-025</td>
			<td></td>
		</tr>
		<tr>
			<td>EZview Red ANTI-FLAG M2 Affinity Gel</td>
			<td>Sigma</td>
			<td>SLBQ1981V</td>
			<td></td>
		</tr>
		<tr>
			<td>Corning 100mm &#215; 20 mm style Dish cell culture treated nonpyrogenic polystyrene 20/sleeve</td>
			<td>Corning&#160;</td>
			<td>430167</td>
			<td></td>
		</tr>
		<tr>
			<td>Protein Lo-Bind Eppendorf</td>
			<td>Fisher Scientific</td>
			<td>13-698-794</td>
			<td></td>
		</tr>
		<tr>
			<td>Digital Vortex Mixer</td>
			<td>Fisher Scientific&#160;</td>
			<td>02-215-370</td>
			<td></td>
		</tr>
		<tr>
			<td>48 hole micro tube foam rack</td>
			<td>Fisher Scientific</td>
			<td>02-215-386</td>
			<td></td>
		</tr>
		<tr>
			<td>Labquake shaker rotisserie&#160;</td>
			<td>Thermo&#160;</td>
			<td>415110</td>
			<td></td>
		</tr>
	</tbody>
</table>

tandem affinity purification of protein complexes from eukaryotic cells

La purificazione della proteina-proteina attiva e complessi acido nucleico-proteina è cruciale per la caratterizzazione delle attività enzimatiche e de novo identificazione di nuovi subunità e modificazioni post-traduzionali. sistemi batterici permettono l&#39;espressione e la purificazione di una grande varietà di singoli polipeptidi e proteine ​​complessi. Tuttavia, questo sistema non consente la purificazione di subunità proteiche che contengono modificazioni post-traduzionali (ad esempio, fosforilazione e acetilazione), e l&#39;identificazione di nuovi subunità regolatorie che sono presenti solo / espressi nel sistema eucariotico. Qui, forniamo una descrizione dettagliata di un romanzo, robusto, ed efficiente metodo di purificazione tandem affinità (TAP) utilizzando STREP- e le proteine ​​FLAG-tag che facilita la purificazione di complessi proteici con transitoriamente o stabilmente espresso proteine ​​epitopi-tag da cellule eucariotiche. Questo protocollo può essere applicata per caratterizzare protEin funzionalità complesse, alla scoperta di modificazioni post-traduzionali su subunità complesse, e per identificare nuovi componenti complessi normativi mediante spettrometria di massa. In particolare, questo metodo TAP può essere applicato per studiare complessi proteici formati da componenti eucariotiche o patogeni (virali e batteriche), ottenendo così una vasta gamma di possibilità sperimentali valle. Proponiamo che i ricercatori che lavorano con i complessi proteici potrebbero utilizzare questo approccio in molti modi diversi.

In questo articolo, abbiamo dimostrato l&#39;applicabilità del metodo TAP per il ben caratterizzato CycT1-CDK9 complesso (noto anche come P-TEFb chinasi). I plasmidi codificanti ciclina T1-STREP (CycT1: S) e CDK9-FLAG (CDK9: F), o CDK9-STREP (CDK9: S) e ciclina T1-FLAG (CycT1: F) (Tabella 1), sono state trasfettate in cellule HEK293T . I controlli negativi inclusi trasfezioni con un vettore vuoto e il CDK9: F o CycT1: (rispettivamente figure 3A e B) plasmidi F. Le proteine ​​sono state espresse per 48 ore prima che le cellule sono state raccolte. Diverse piastre di cellule sono stati usati per esperimento (cinque piastre per campione sono stati utilizzati per i dati presentati in Figura 3) per aumentare la produzione ed il recupero di proteine. Dopo che le cellule sono state lisate in tubi da microcentrifuga individuali, i lisati cellulari dello stesso campione sono stati combinati in un unico microcentrifTubo uge prima di aggiungere le perline streptococco. Combinando i campioni di proteine ​​con una porzione di perline aumenta la concentrazione proteica finale, che può migliorare il recupero proteina da proteine ​​che sono difficili da esprimere. Dopo l&#39;eluizione iniziale, una seconda eluizione può essere realizzata in modo da aumentare il quantitativo totale di proteine ​​per il PI FLAG. È importante salvare l&#39;input per ogni fase di purificazione prima di aggiungere le perline per la ricerca guasti futuro (Tabella 2), se necessario. I dati nella Figura 3A mostra i risultati del metodo TAP per CycT1: S e CDK9: F, analizzati mediante western blot. CDK9: F co-eluito con CycT1: S dalle perline STREP, ma non nel controllo negativo AP manca CycT1: S, che indica che CDK9: F e CycT1: S formano un complesso proteina-proteina. Come previsto, entrambe le proteine ​​sono state rilevate nel eluizione FLAG, che ha confermato ulteriormente la formazione del complesso. Figura 3B mostra la resuLTS del metodo reciproco TAP, dove sono stati scambiati i tag epitopo della due proteine ​​(CDK9: S e CycT1: F), e analizzati mediante Western Blot. Figure 3C e 3D mostrano i risultati del TAP e TAP reciproca analizzato mediante colorazione argento rispettivamente. Figura 3C corsia 2 ha mostrato che CDK9: F co-eluito con CycT1: S al largo delle perline STREP, ma non dal AP di controllo (corsia 1), indicando così che CDK9: F e CycT1: S formato un complesso proteina-proteina. Nella successiva eluizione FLAG, come mostrato in corsia 4, CycT1: S co-eluito con CDK9: F largo delle perline FLAG. Analogamente, Figura 3D mostrato che CycT1: F co-eluito con CDK9: S off delle perline STREP, ma non dal AP controllo e che il complesso proteina-proteina era efficiente recuperato dopo la seconda fase FLAG IP. Entrambe le macchine occidentali e le macchie d&#39;argento hanno confermato che il protocollo TAP ha lavorato in modo efficiente per la purificatio<html> n, l&#39;isolamento e la caratterizzazione del complesso proteina di interesse. <img alt="Figura 1" src="/files/ftp_upload/55236/55236fig1.jpg" /> Figura 1: Panoramica della strategia TAP Purificazione. Un semplice schema che descrive i passi di TAP. I plasmidi che codificano per la proteina di interesse sia con il tag epitopo STREP o FLAG sono co-trasfettato in cellule di mammifero. Dopo 48 h di induzione, le cellule sono raccolte e lisate. lisato cellulare solubile contenente la proteina di interesse insieme ad altre proteine ​​sono caricati sul perline STREP per STREP AP. Le proteine ​​che contengono sia il tag STREP o sono legati alla proteina STREP-tag attaccati alle perle sono poi eluiti. Le perle FLAG sono stati poi aggiunti nella eluizione STREP. Le proteine ​​che contengono sia il tag bandiera o sono legati alla proteina FLAG-tag attaccati alle perle sono poi eluiti. Eluizioni potrebbe essere analizzato con i metodi indicati.TTP: //ecsource-jove-com.remotexs.ntu.edu.sg/files/ftp_upload/55236/55236fig1large.jpg &quot;target =&quot; _ blank &quot;&gt; Clicca qui per vedere una versione più grande di questa figura. <img alt="figura 2" src="/files/ftp_upload/55236/55236fig2.jpg" /> Figura 2: Rappresentazione schematica della strategia TAP. Un protocollo dettagliato di TAP. Vedere il testo per i dettagli. <a href="https://ecsource-jove-com.remotexs.ntu.edu.sg/files/ftp_upload/55236/55236fig2large.jpg" target="_blank">Clicca qui per vedere una versione più grande di questa figura.</a> <img alt="Figura 3" src="/files/ftp_upload/55236/55236fig3.jpg" /> Figura 3: esempio di analisi Step-by-step di TAP Purificazione. (A) Analisi Western Blot di TAP (CycT1: S e CDK9: F). (B) Analisi Western Blot di TAP reciproca (CDK9: S e CycT1: F). indietrom 1 ml di tutto lisato cellulare, 5 microlitri (0,2%) sono stati caricati come &quot;STREP AP Input.&quot; 975 ml di rimanere tutto il lisato cellulare è stato aggiunto al perline STREP per STREP AP e 100 ml di &quot;STREP AP eluizione&quot; è stato raccolto. Da questo, 5 microlitri (2%) è stato caricato. 80 ml di &quot;STREP AP eluizione&quot; è stato aggiunto al perline Flag per IP bandiera e 30 ml di &quot;IP eluizione FLAG&quot; è stato raccolto. Dalle 30 pl di &quot;IP eluizione FLAG&quot;, 7 ml (23,3%) è stato caricato. (C) analisi macchia d&#39;argento di TAP (CycT1: S e CDK9: F). Analisi (D) Silver macchia di TAP reciproca (CDK9: S e CycT1: F). 5 ml (2%) di &quot;STREP AP eluizione&quot; e 7 ml (23,3%) di &quot;IP eluizione flag&quot; sono stati caricati. Gli asterischi indicano impurità co-eluiti. <a href="https://ecsource-jove-com.remotexs.ntu.edu.sg/files/ftp_upload/55236/55236fig3large.jpg" target="_blank">Clicca qui per vedere una versione più grande di questa figura.</a> <table fo:keep-together.within-page = &quot;1&quot; fo: keep-con-next.within-page = &quot;always&quot;&gt; <tbody><tr><td> Proteina </td><td> residui </td><td> Vettore </td><td> Etichetta </td><td> siti clonazione </td><td> Riferimento </td></tr><tr><td> CycT1 </td><td> 1-708 </td><td> pcDNA / 4TO </td><td> STREP </td><td> HindIII - EcoRI </td><td> McNamara et al. 2013 10 </td></tr><tr><td> CycT1 </td><td> 1-708 </td><td> pcDNA / 4TO </td><td> BANDIERA </td><td> HindIII - EcoRI </td><td> Questo articolo </td></tr><tr><td> CDK9 </td><td> 1-372 </td><td> pcDNA / 4TO </td><td> STREP </td><td> HindIII - XhoI </td><td> Questo articolo </td></tr><tr><td> CDK9 </td><td> 1-372 </td><td> pcDNA / 4TO </td><td> FLAG </td><td> HindIII - XhoI </td><td> McNamara et al. 2013 10 </td></tr><tr><td> GFP </td><td> 1-238 </td><td> pcDNA / 4TO </td><td> STREP-FLAG </td><td> BamHI - XhoI </td><td> Questo articolo </td></tr></tbody></table> Tabella 1: I plasmidi utilizzati in questo studio. CycT1 e CDK9 stati legati nel pcDNA / 4TO-STREP e vettori plasmidici pcDNA / 4TO-FLAG. Questi costrutti sono state trasformate in cellule competenti DH5α e placcato su piastre LB-ampicillina. Le colonie sono state selezionate, coltivate e proiettati. Successo cloni legatura sono stati verificati mediante sequenziamento Sanger e la combinazione della restrizione digestione e elettroforesi su gel di agarosio. Per CycT1 abbiamo usato una versione più breve (1 - 708) invece del full-length (1 - 726) perché gli ultimi 18 residui contengono una sequenza PEST (una sequenza peptidica riccoprolina, acido glutammico, serina, treonina e), che agisce come un peptide segnale per la degradazione proteica 20. CDK9 era full-length. La sequenza del tag tandem STREP è il seguente: GGGGWSHPQFEKGGGSGGGSGGGSWSHPQFEK. La sequenza del tag FLAG tandem è il seguente: GGGGDYKDHDGDYKDHDIDYKDDDDK. Tabella 2: risoluzione dei problemi Tabella. Prima di iniziare con la risoluzione dei problemi, doppio controllo per assicurarsi che ogni passo essenziale è stato seguito. Alcune fasi di questo protocollo richiedono più l&#39;ottimizzazione di altri a conseguire il risultato previsto. <a href="https://ecsource-jove-com.remotexs.ntu.edu.sg/files/ftp_upload/55236/Book2.xlsx">Clicca qui per scaricare il file.</a>

Watch this Scientific Journal Video about Tandem Affinity Purification of Protein Complexes from Eukaryotic Cells at JoVE.com

Tandem Affinity Purification of Protein Complexes from Eukaryotic Cells

We describe here a novel, robust, and efficient tandem affinity purification (TAP) method for the expression, isolation, and characterization of protein complexes from eukaryotic cells. This protocol could be utilized for the biochemical characterization of discrete complexes as well as the identification of novel interactors and post-translational modifications that regulate their function.

Tandem Affinity Purification di complessi proteici da cellule eucariotiche

The purification of active protein-protein and protein-nucleic acid complexes is crucial for the characterization of enzymatic activities and de novo ...

tandem-affinity-purification-protein-complexes-from-eukaryotic

Nanyang Technological University

Research

JoVE Journal

Biochemistry

14.8K Views.  The University of Texas Southwestern Medical Center. We describe here a novel, robust, and efficient tandem affinity purification (TAP) method for the expression, isolation, and characterization of protein complexes from eukaryotic cells. This protocol could be utilized for the biochemical characterization of discrete complexes as well as the identification of novel interactors and post-translational modifications that regulate their function.

Video: Tandem Affinity Purification of Protein Complexes from Eukaryotic Cells

Isolation of Cognate RNA-protein Complexes from Cells Using Oligonucleotide-directed Elution

Ribonucleoprotein particles direct the biogenesis and post-transcriptional regulation of all mRNAs through distinct combinations of RNA binding proteins. They are composed of position-dependent, cis-acting RNA elements and unique combinations of RNA binding proteins. Defining the composition of a specific RNP is essential to achieving a fundamental understanding of gene regulation. The isolation of a select RNP is akin to finding a needle in a haystack. Here, we demonstrate an approach to isolate RNPs associated at the 5' untranslated region of a select mRNA in asynchronous, transfected cells. This cognate RNP has been demonstrated to be necessary for the translation of select viruses and cellular stress-response genes.
The demonstrated RNA-protein co-precipitation protocol is suitable for the downstream analysis of protein components through proteomic analyses, immunoblots, or suitable biochemical identification assays. This experimental protocol demonstrates that DHX9/RNA helicase A is enriched at the 5' terminus of cognate retroviral RNA and provides preliminary information for the identification of its association with cell stress-associated huR and junD cognate mRNAs.

This manuscript describes an approach to isolate select cognate RNPs formed in eukaryotic cells via a specific oligonucleotide-directed enrichment. We demonstrate the applicability of this approach by isolating a cognate RNP bound to the retroviral 5' untranslated region that is composed of DHX9/RNA helicase A.

Isolamento di cognate Complessi RNA-proteina da Cellule con eluizione oligonucleotidi-diretto

Ribonucleoprotein particles direct the biogenesis and post-transcriptional regulation of all mRNAs through distinct combinations of RNA binding proteins. ...

Ricerca

Biochimica

Protein Complex Affinity Capture from Cryomilled Mammalian Cells

Affinity capture is an effective technique for isolating endogenous protein complexes for further study. When used in conjunction with an antibody, this technique is also frequently referred to as immunoprecipitation. Affinity capture can be applied in a bench-scale and in a high-throughput context. When coupled with protein mass spectrometry, affinity capture has proven to be a workhorse of interactome analysis. Although there are potentially many ways to execute the numerous steps involved, the following protocols implement our favored methods. Two features are distinctive: the use of cryomilled cell powder to produce cell extracts, and antibody-coupled paramagnetic beads as the affinity medium. In many cases, we have obtained superior results to those obtained with more conventional affinity capture practices. Cryomilling avoids numerous problems associated with other forms of cell breakage. It provides efficient breakage of the material, while avoiding denaturation issues associated with heating or foaming. It retains the native protein concentration up to the point of extraction, mitigating macromolecular dissociation. It reduces the time extracted proteins spend in solution, limiting deleterious enzymatic activities, and it may reduce the non-specific adsorption of proteins by the affinity medium. Micron-scale magnetic affinity media have become more commonplace over the last several years, increasingly replacing the traditional agarose- and Sepharose-based media. Primary benefits of magnetic media include typically lower non-specific protein adsorption; no size exclusion limit because protein complex binding occurs on the bead surface rather than within pores; and ease of manipulation and handling using magnets.

Here we describe protocols to disrupt mammalian cells by solid-state milling at a cryogenic temperature, produce a cell extract from the resulting cell powder, and isolate protein complexes of interest by affinity capture upon antibody-coupled micron-scale paramagnetic beads.

Proteine ​​Complesso affinità Acquisizione da cellule di mammifero Cryomilled

Affinity capture is an effective technique for isolating endogenous protein complexes for further study. When used in conjunction with an antibody, this ...

Resolving Affinity Purified Protein Complexes by Blue Native PAGE and Protein Correlation Profiling

Most proteins act in association with others; hence, it is crucial to characterize these functional units in order to fully understand biological processes. Affinity purification coupled to mass spectrometry (AP-MS) has become the method of choice for identifying protein-protein interactions. However, conventional AP-MS studies provide information on protein interactions, but the organizational information is lost. To address this issue, we developed a strategy to unravel the distinct functional assemblies a protein might be involved in, by resolving affinity-purified protein complexes prior to their characterization by mass spectrometry. Protein complexes isolated through affinity purification of a bait protein using an epitope tag and competitive elution are separated through blue native electrophoresis. Comparison of protein migration profiles through correlation profiling using quantitative mass spectrometry allows assignment of interacting proteins to distinct molecular entities. This method is able to resolve protein complexes of close molecular weights that might not be resolved by traditional chromatographic techniques such as gel filtration. With little more work than conventional AP-geLC-MS/MS, we demonstrate this strategy may in many cases be adequate for obtaining protein complex topological information concomitantly to identifying protein interactions.

Here we present protocols for affinity purification of protein complexes and their separation by blue native PAGE, followed by protein correlation profiling using label free quantitative mass spectrometry. This method is useful to resolve interactomes into distinct protein complexes.

Risoluzione purificato per affinità complessi proteici di Blue Native PAGE e proteine ​​correlazione Profiling

Most proteins act in association with others; hence, it is crucial to characterize these functional units in order to fully understand biological ...

2 in 1: One-step Affinity Purification for the Parallel Analysis of Protein-Protein and Protein-Metabolite Complexes

Cellular processes are regulated by interactions between biological molecules such as proteins, metabolites, and nucleic acids. While the investigation of protein-protein interactions (PPI) is no novelty, experimental approaches aiming to characterize endogenous protein-metabolite interactions (PMI) constitute a rather recent development. Herein, we present a protocol that allows simultaneous characterization of the PPI and PMI of a protein of choice, referred to as bait. Our protocol was optimized for Arabidopsis cell cultures and combines affinity purification (AP) with mass spectrometry (MS)-based protein and metabolite detection. In short, transgenic Arabidopsis lines, expressing bait protein fused to an affinity tag, are first lysed to obtain a native cellular extract. Anti-tag antibodies are used to pull down protein and metabolite partners of the bait protein. The affinity-purified complexes are extracted using a one-step methyl tert-butyl ether (MTBE)/methanol/water method. Whilst metabolites separate into either the polar or the hydrophobic phase, proteins can be found in the pellet. Both metabolites and proteins are then analyzed by ultra-performance liquid chromatography-mass spectrometry (UPLC-MS or UPLC-MS/MS). Empty-vector (EV) control lines are used to exclude false positives. The major advantage of our protocol is that it enables identification of protein and metabolite partners of a target protein in parallel in near-physiological conditions (cellular lysate). The presented method is straightforward, fast, and can be easily adapted to biological systems other than plant cell cultures.

Protein-protein and protein-metabolite interactions are crucial for all cellular functions. Herein, we describe a protocol that allows parallel analysis of these interactions with a protein of choice. Our protocol was optimized for plant cell cultures and combines affinity purification with mass spectrometry-based protein and metabolite detection.

2 in 1: purificazione di affinità per l'analisi parallela di proteina-proteina e proteina-metabolita complessi in un unico passaggio

Cellular processes are regulated by interactions between biological molecules such as proteins, metabolites, and nucleic acids. While the investigation of ...

An Oligonucleotide-based Tandem RNA Isolation Procedure to Recover Eukaryotic mRNA-Protein Complexes

RNA-binding proteins (RBPs) play key roles in the post-transcriptional control of gene expression. Therefore, biochemical characterization of mRNA-protein complexes is essential to understanding mRNA regulation inferred by interacting proteins or non-coding RNAs. Herein, we describe a tandem RNA isolation procedure (TRIP) that enables the purification of endogenously formed mRNA-protein complexes from cellular extracts. The two-step protocol involves the isolation of polyadenylated mRNAs with antisense oligo(dT) beads and subsequent capture of an mRNA of interest with 3&#39;-biotinylated 2&#39;-O-methylated antisense RNA oligonucleotides, which can then be isolated with streptavidin beads. TRIP was used to recover in vivo crosslinked mRNA-ribonucleoprotein (mRNP) complexes from yeast, nematodes and human cells for further RNA and protein analysis. Thus, TRIP is a versatile approach that can be adapted to all types of polyadenylated RNAs across organisms to study the dynamic re-arrangement of mRNPs imposed by intracellular or environmental cues.

A tandem RNA isolation procedure (TRIP) for recovery of endogenously formed mRNA-protein complexes is described. Specifically, RNA-protein complexes are crosslinked in vivo, polyadenylated RNAs are isolated from extracts with oligo(dT) beads, and particular mRNAs are captured with modified RNA antisense oligonucleotides. Proteins bound to mRNAs are detected by immunoblot analysis.

Una procedura di isolamento del RNA basati su Oligonucleotide Tandem recuperare mRNA-proteina eucariotica complessi

RNA-binding proteins (RBPs) play key roles in the post-transcriptional control of gene expression. Therefore, biochemical characterization of mRNA-protein ...

Affinity Purification of Chloroplast Translocon Protein Complexes Using the TAP Tag

Chloroplast biogenesis requires the import of thousands of nucleus-encoded proteins into the plastid. The import of these proteins depends on the translocon at the outer (TOC) and inner (TIC) chloroplast membranes. The TOC and TIC complexes are multimeric and probably contain yet unknown components. One of the main goals in the field is to establish the complete inventory of TOC and TIC components. For the isolation of TOC-TIC complexes and the identification of new components, the preprotein receptor TOC159 has been modified N-terminally by the addition of the tandem affinity purification (TAP) tag resulting in TAP-TOC159. The TAP-tag is designed for two sequential affinity purification steps (hence "tandem affinity"). The TAP-tag used in these studies consists of a N-terminal IgG-binding domain derived from Staphylococcus aureus Protein A (ProtA) followed by a calmodulin-binding peptide (CBP). Between these two affinity tags, a tobacco etch virus (TEV) protease cleavage site has been included. Therefore, TEV protease can be used for gentle elution of TOC159-containing complexes after binding to IgG beads. In the protocol presented here, the second Calmodulin-affinity purification step was omitted. The purification protocol starts with the preparation and solubilization of total cellular membranes. After the detergent-treatment, the solubilized membrane proteins are incubated with IgG beads for the immunoisolation of TAP-TOC159-containing complexes. Upon binding and extensive washing, TAP-TOC159 containing complexes are cleaved and released from the IgG beads using the TEV protease whereby the S. aureus IgG-binding domain is removed. Western blotting of the isolated TOC159-containing complexes can be used to confirm the presence of known or suspected TOC and TIC proteins. More importantly, the TOC159-containing complexes have been used successfully to identify new components of the TOC and TIC complexes by mass spectrometry. The protocol that we present potentially allows the efficient isolation of any membrane-bound protein complex to be used for the identification of yet unknown components by mass spectrometry.

We here present a proven and tested protocol for the purification of chloroplast protein import complexes (TOC-TIC complex) using the TAP-tag. The one-step affinity-isolation protocol can potentially be applied to any protein and be used to identify new interaction partners by mass spectrometry.

Purificazione di affinità del cloroplasto Translocon proteina complessi usando il Tag di rubinetto

Chloroplast biogenesis requires the import of thousands of nucleus-encoded proteins into the plastid. The import of these proteins depends on the ...

Expression, Solubilization, and Purification of Eukaryotic Borate Transporters

The Solute Carrier 4 (SLC4) family of proteins is called the bicarbonate transporters and includes the archetypal protein Anion Exchanger 1 (AE1, also known as Band 3), the most abundant membrane protein in the red blood cells. The SLC4 family is homologous with borate transporters, which have been characterized in plants and fungi. It remains a significant technical challenge to express and purify membrane transport proteins to homogeneity in quantities suitable for&#160;structural or functional studies. Here we describe detailed procedures for the overexpression of borate transporters in Saccharomyces cerevisiae, isolation of yeast membranes, solubilization of protein by detergent, and purification of borate transporter homologs from S. cerevisiae, Arabidopsis thaliana, and Oryza sativa. We also detail a glutaraldehyde cross-linking experiment to assay multimerization of homomeric transporters. Our generalized procedures can be applied to all three proteins and have been optimized for efficacy. Many of the strategies developed here can be utilized for the study of other challenging membrane proteins.

Here we present a protocol to express, solubilize, and purify several eukaryotic borate transporters with homology to the SLC4 transporter family using yeast. We also describe a chemical cross-linking assay to assess the purified homomeric proteins for multimeric assembly. These protocols can be adapted for other challenging membrane proteins.

Espressione, solubilizzazione e purificazione dei trasportatori eucariotiche borato

The Solute Carrier 4 (SLC4) family of proteins is called the bicarbonate transporters and includes the archetypal protein Anion Exchanger 1 (AE1, also ...

Translating Ribosome Affinity Purification (TRAP) for RNA Isolation from Endothelial Cells In Vivo

Many studies have been limited to using in vitro cellular assays and whole tissues or isolating of specific cell types from animals for in vitro analysis of transcriptome and gene expression by qPCR and RNA sequencing. Comprehensive transcriptome and gene expression analysis of specific cell types in complex tissues and organs will be critical to understand cellular and molecular mechanisms by which genes are regulated and their association with tissue homeostasis and organ functions. In this article, we demonstrate the methodology for isolation of ribosome-bound RNA directly in vivo in the vascular endothelia of animal lungs as an example. The specific materials and procedures for tissue processing and RNA purification will be described, including the assessment of RNA quality and yield as well as real time qPCR for arteriogenic gene assays. This approach, known as translating ribosome affinity purification (TRAP) technique, can be utilized for characterization of gene expression and transcriptome analysis of certain cell types directly in vivo in any specific type in complex tissues.

Translating Ribosome Affinity Purification TRAP for RNA Isolation from Endothelial Cells In Vivo

We present an approach to purify ribosome-bound mRNA from vascular endothelial cells (ECs) directly in mouse brain, lung and heart tissues via EC-specific genetic tag of enhanced green fluorescence protein (EGFP)in ribosomes in combination with RNA purification.

Traduzione della purificazione dell'affinità del ribosoma (TRAP) per l'isolamento dell'RNA dalle cellule endoteliali In vivo

Many studies have been limited to using in vitro cellular assays and whole tissues or isolating of specific cell types from animals for in vitro analysis ...

Bacterial Expression and Purification of Human Matrix Metalloproteinase-3 using Affinity Chromatography

Matrix metalloproteinases (MMPs) belong to the family of metzincin proteases with central roles in extracellular matrix (ECM) degradation and remodeling, as well as interactions with several growth factors and cytokines. Overexpression of specific MMPs is responsible in several diseases such as cancer, neurodegenerative diseases, and cardiovascular disease. MMPs have been the center of attention recently as targets to develop therapeutics that can treat diseases correlated to MMP overexpression.
To study the MMP mechanism in solution, more facile and robust recombinant protein expression and purification methods are needed for the production of active, soluble MMPs. However, the catalytic domain of most MMPs cannot be expressed in Escherichia coli (E. coli) in soluble form due to lack of posttranslational machinery, whereas mammalian expression systems are usually costly and have lower yields. MMP inclusion bodies must undergo the tedious and laborious process of extensive purification and refolding, significantly reducing the yield of MMPs in native conformation. This paper presents a protocol using Rosetta2(DE3)pLysS (hereafter referred to as R2DP) cells to produce matrix metalloproteinase-3 catalytic domain (MMP-3cd), which contains an N-terminal His-tag followed by pro-domain (Hisx6-pro-MMP-3cd) for use in affinity purification. R2DP cells enhance the expression of eukaryotic proteins through a chloramphenicol-resistant plasmid containing codons normally rare in bacterial expression systems. Compared to the traditional cell line of choice for recombinant protein expression, BL21(DE3), purification using this new strain improved the yield of purified Hisx6-pro-MMP-3cd. Upon activation and desalting, the pro domain is cleaved along with the N-terminal His-tag, providing active MMP-3cd for immediate use in countless in vitro applications. This method does not require expensive equipment or complex fusion proteins and describes rapid production of recombinant human MMPs in bacteria.

His-tag purification, dialysis, and activation are employed to increase yields of soluble, active matrix metalloproteinase-3 catalytic domain protein expression in bacteria. Protein fractions are analyzed via SDS-PAGE gels.

Espressione batterica e purificazione della metalloproteinasi-3 della matrice umana mediante cromatografia di affinità

Matrix metalloproteinases (MMPs) belong to the family of metzincin proteases with central roles in extracellular matrix (ECM) degradation and remodeling, ...

Extraction and Purification of FAHD1 Protein from Swine Kidney and Mouse Liver

Fumarylacetoacetate hydrolase domain-containing protein 1 (FAHD1) is the first identified member of the FAH superfamily in eukaryotes, acting as oxaloacetate decarboxylase in mitochondria. This article presents a series of methods for the extraction and purification of FAHD1 from swine kidney and mouse liver. Covered methods are ionic exchange chromatography with fast protein liquid chromatography (FPLC), preparative and analytical gel filtration with FPLC, and proteomic approaches. After total protein extraction, ammonium sulfate precipitation and ionic exchange chromatography were explored, and FAHD1 was extracted via a sequential strategy using ionic exchange and size-exclusion chromatography. This representative approach may be adapted to other proteins of interest (expressed at significant levels) and modified for other tissues. Purified protein from tissue may support the development of high-quality antibodies, and/or potent and specific pharmacological inhibitors.

This protocol describes how to extract fumarylacetoacetate hydrolase domain-containing protein 1 (FAHD1) from swine kidney and mouse liver. The listed methods may be adapted to other proteins of interest and modified for other tissues.