우리는 질량 분석 분석 및 유용한 의견에 대 한 박사 데이비드 킹, 하 워드 휴즈 의학 연구소, 캘리포니아 대학 버클리를 감사합니다. 우리는 박사 Xuelian 주, 상하이, 생물 과학을 위한 학회, 과학의 중국 아카데미, 상하이, 중국 전체 길이 CENP F 구조를 제공 하기 위한 감사 합니다. 마지막으로, 우리는 감사 박사 수잔 베인 박사 브라이언 칼라, 빙 엄 턴 대학에서 박사 Christof Grewer 장비에 대 한 액세스. 이 연구는 뉴욕의 주립 대학 및 대학의 뉴욕 주립 빙햄 턴 화학과 연구 재단에 의해 투자 되었다.

저자는 공개 없다.

우리의 생체 외에서 니 분석 결과 세포 주기의 마스터 컨트롤러 및 많은 중요 한 세포질 과정을 조절 키 Cdk1를 위한 분자 표적을 식별 하는 매우 강력한 방법입니다. 메서드는 순화 된 단백질 Cdk1에 대 한 기판 이며 수 인 산화 특정 사이트의 경우 결정 합니다. 이 Cdk1 통해 인 산화에 의해 세포 프로세스의 규칙을 위한 기계 연구를 촉진 한다.
질량 분석에 의해 인 산화 위치의 성공적인 식별에 대 한 가장 중요 한 요소 니 분석 결과의 인 산화 효율입니다. 개별 사이트의 인 산화 효율 이어야 한다, 높은 선호 100%. 이 Cdk1/ B의 양을 증가 하 고 16 h 배양 시간에 의해 얻을 수 있습니다. 때 Cdk1/ B, 단백질과 사이트를 고려해 야 하는 인 산화 수의 어 금 니 농도의 양을 계산 합니다. 이것이 여러 인 산화 위치는 대상 단백질에 존재 하는 경우에 특히 중요 합니다. 그것은 상업 Cdk1/ B의 활동 배치에서 배치, 다 수 고는 키 니 아 제 활동을 빠르게 잃을 수 있습니다 주목도 한다. 인 산화 체 외에 실패할 경우는 키 니 아 제 활동을 테스트 하는 것이 좋습니다. 문제 해결을 위한 긍정적인 컨트롤로, CENP-F (잔류물 2,987-3065)의 인 산화 체 외에서 사용할 수 있습니다. 부정적인 통제로 Cdk1/ B 추가 없이 반응 해야 수행 되며 분석. 또 다른 유용한 부정적인 통제는 촉매로, 간단한 점 돌연변이 (D146N)47,,4849인 Cdk1의 키-죽은 돌연변이의 사용 이다. 또한, 확인 된 인 산화 위치를 확인 하려면 대상 단백질의 phosphonegative 버전을 만들 수 있습니다, 인 산화 사이트 alanines에 의해 대체 됩니다. 확인 된 인 산화 사이트가 올바른 경우, 해당 phosphonegative 돌연변이 phosphorylated 체 외수 없습니다.
성공적인 인 산화는 표적 단백질의 검출 하는 간단한 도구가입니다 여기에 설명 된 간단한 SDS 페이지 젤 교대 분석. Phosphorylated 단백질은 일반적으로 느리게 SDS 페이지에 추가 크기와 음 전 unphosphorylated 들 보다 마이그레이션합니다. Note는 큰 단백질에 대 한 SDS 페이지 분석의 최적화 하는 데 필요한 시각화 젤 교대를 충분히 해상도 향상. 유용한 도구 phosphorylated 단백질의 특정 분리에 대 한 인산 염-바인딩 태그 (태그 포스) SDS 페이지. Phosphorylated 단백질 젤 포스 태그 아크릴 준비에 해당에 비해 느린 마이그레이션 밴드 dephosphorylated 단백질50,51으로 시각화 됩니다.
높은 품질 질량 스펙트럼을 얻기 위해 생체 외에서 니 분석 결과 대 한 단백질은 순수 하 고 균질 매우 중요 하다. 우리의 정화 프로토콜 몇 가지 매우 선택적 크로마토그래피 단계를 결합 하 여 고 단백질 저하 고 protease 억제제 및 reductants의 추가 통해 산화를 방지 하 여이 달성 한다. 정화 프로토콜 (즉, GST-태그 그대로); 티로 단백질을 elute를 수정할 수 있습니다. 그러나, 그것은 GST-태그 추가 다른 25 kDa, 및 큰 단백질 질량 분석에 대 한 목표 도전 고려 되어야 한다. 또는, 그의6에 대 한 우리의 정화 프로토콜-태그 융해 단백질을 사용할 수 있습니다.
이 프로토콜은 또한 다른 kinases에 관련 된 인 산화 사이트 식별 수정할 수 있습니다. 유일한 요구 사항은 정화 니 사용할 수 있는, 적극적인, 그리고 충분히 안정적입니다. 시험 조건을 최대 활동을 달성 하기 위해 각 키에 대 한 조정 될 필요가 있다. 매개 변수를 최적화 하는 키 니 아 제, 반응 버퍼 (pH, 염 농도), 보육 시간, 반응 온도, 및 ATP 농도의 양을 포함 합니다. 키 니 아 제 분석 실험 체 외에 성공적으로 사용 되었습니다 많은 등 Plks (폴로 같은 kinases)52,,5354, kinases와 MAPK/ERK kinases (물질 활성화 단백질 인 산화 사이트 식별 kinases extracellular 신호 통제 / kinases)55,56.
이 방법의 강도 순화 된 단백질의 인 산화 특정 사이트를 식별 하는, Cdk1 체 외 를 인 산화 사이트 반드시 phosphorylated 비보되지 않을 수 있습니다 주목 해야한다. 비비 안에o, 추가적인 규제 메커니즘 장소, 인 산화 사이트 Cdk1에 의해 인식에 대 한 액세스할 수 없게 렌더링 수 있습니다. 예를 들어 추가 상호 파트너 존재 vivo에서, 수 인 산화 사이트를 은폐 하거나 구조 변화를 통해 액세스할 수 있도록 수 있습니다. 또한, 기판 phosphorylated 될 위해서는 G2 단계에서 핵에 있는 Cdk1/ b colocalize 필요 합니다. 또한, 포스트 번역 상 수정 또는 다른 규제 프로세스 수 영향을 대상 단백질에 vivo에서, 인 산화 사이트를 액세스할 수 없는 렌더링할 수 있는 구조. 셀 또는 확인 된 인 산화 사이트 생리 기능 확인 동물 모델에서 적절 한 실험을 설계 하 여 이러한 한계를 극복할 수 있습니다. 여기, 우리 기능 검증에 대 한 간단한 바인딩 분석 결과 사용 하 여, karyopherin α. 기능 검증 CENP F의 상호 셀 컨텍스트 또는 동물 모델에서 수행도 인 산화 감소 때문. 따라서, 우리는 또한 헬러 세포10에 cNLS를 포함 하는 CENP-F-파편의 형광 성 융해 단백질 페. Phosphomimetic 돌연변이 cNLS에서 CENP-F의 핵 지역화, 확인이 인 산화 사이트10의 생리 기능 저하.
몇 가지 도구 기능 검증 인 산화 위치의 셀 또는 동물 모델에서 사용할 수 있습니다. 음 전 여 인 산화의 효과 모방, Phosphomimetic 돌연변이이 목적을 위해 널리 이용 된다. 이들을 위해, 인 산화 사이트 (떠들고 또는 트레오닌) aspartate 또는 조미료로 대체 됩니다. 이점은 대상 단백질의 돌연변이 포인트 필요 하다는 것 이다. 그것은 지적 한다, 그 동안 phosphomimetic 돌연변이 기능 검증에 대 한 많은 경우에 성공적으로 사용 했다, 그들은 특히 작동 경우 요금 변경이 구조적 변화 보다는 규제에 대 한 주된 기여는 어디에. Phosphomimetic 돌연변이 (예를 들어, 11) 많은 경우에 인 산화의 효과 모방 하기 위해 실패 합니다. 그러나, 다른 접근 phosphonegative 돌연변이의 사용을 포함 하 여 인 산화 위치의 기능 확인을 위해 사용할 수 있습니다:이 돌연변이 알라닌과 인 산화 사이트를 대체 하 여 인 산화를 방지. 세포질 컨텍스트에서 기능 검증을 위한 또 다른 유용한 방법은 소개 지점 돌연변이 (D146N)47,,4849에 의해 활동 되지 않 ㄴ Cdk1의 키-죽은 돌연변이의 표현 이다. 특히, 여러 작은 분자 Cdk1 억제제로-3306, 셀 또는 동물 모델7,,811기능 연구에 사용 될 수 있는 Flavopiridol 등 상업적으로 사용할 수 있습니다. 이 억제제 잘 특징이 있으며 (리뷰 참조9)에 대 한 암 치료에 대 한 임상 실험에는.
동안 많은 수의 단백질 인 산화 사이트 proteomic 연구에 확인 되었습니다, 키 니 아 제 특이성 알 수 없는, 대부분의 경우 이며 생체 외에서 니 분석 결과 Cdk1의 기질을 식별 하기 위해 사용할 수 있는 몇 가지 방법 중 하나입니다. 다른 접근 방식 또한 사용 되었습니다. Cdk1 대상 설계 Cdk1 효소를 사용 하 여 확인 되었다. 그것은 큰 기판 바인딩 주머니는 고 기판6으로 ATP의 더 큰 버전을 허용. 이 대형 기판 야생-타입 kinases 바인딩할 수 없습니다. 셀 방사선된 부피가 ATP의 추가 추출 수정된 Cdk1 효소는 그러므로 Cdk1. 직접 기판의 특정 라벨에 리드를 포함 200 Cdk1 목표는 신진 효 모에이 방법; 확인 되었다 그러나, 그것은 적용할 수 없습니다 포유류 세포에 중요 한 제한입니다. 또 다른 연구에서는 Cdk1 기판은 Cdk1, Flavopiridol, 및 RO-3306 두 작은 분자 억제제를 사용 하 여 양적 phosphoproteomics 분석을 수행 하 여 인간의 조직 배양 세포에서 발견 됐다. 551 단백질에 1215 phosphopeptides Cdk1 억제제 추가7시 크게 감소 되었다. 이 방법은 잠재적인 Cdk1 대상에 대 한 전체 프로테옴 화면 수 있습니다 있지만 결과 확인할 필요가 목표, 예를 들면, 생체 외에서 키에 의해 분석 결과.
미래에 생체 외에서 니 분석 결과 가능성이 높은 처리량에 현재 개발 중인 Cdk1 기판에 대 한 화면으로 결합 됩니다. 프로테옴의 Cdk1 기판의 많은 수 때문 많은 인간 Cdk1 기판 확인할 수를 유지 하 고 생체 외에서 니 분석 결과 식별, 지도, 및 이러한 사이트를 확인 하는 중요 한 도구가 될 것입니다.
생체 외에서 니 분석 결과 키 Cdk1에 대 한 목표를 식별 하 고 인 산화 특정 사이트를 식별 하는 강력한 도구 이다. 이 인 산화 위치의 식별 기계 연구를 Cdk1에 의해 세포질 과정의 규칙에 대 한 수 있습니다.

Kinases는 기판에 ATP에서 인산 염 그룹을 전송 하 고 많은 세포질 과정을 조절 하는 효소. 이 인 산화 되돌릴 수, 빠르고, 두 부정적인 요금을 추가 및 저장 자유 에너지, 하 고 셀에서 사용 하는 가장 일반적인 posttranslational 수정 중 하나입니다. Cdk1, 일컬어 세포 주기 단백질 2 체 (cdc2)는 모든 진핵생물1,2,3,,45, 세포 주기 위해 마스터 컨트롤러가 고 phosphorylates는 프로테옴6,7의 예상된 8-13%.
최근 proteomic 연구는 단백질, 대부분의 경우에서에 많은 인 산화 사이트를 확인 하는 동안 키 이러한 수정에 대 한 책임을 알 수 있다. 인간 세포에서 특히 알려진된 Cdk1 목표의 수는 낮은7. Cdk1-특정 한 인 산화 위치의 식별 Cdk1 세포 주기를 제어 하는 방법을 설정 하는 기계 론 적인 연구를 하면 그것은 중요 하다. 세포 주기 규칙은 충실 한 염색체 분리 및 세포 분열에 대 한 중요 한 그리고 세포질 과정의 무수 한이 중요 한 생리 기능을 지원 하기 위해 발생 해야 합니다. 전사와 유사 분열, 세포의 구조와 핵, 염색체 응축, mitotic 스핀 들 어셈블리의 분해 등의 조직에 극적인 개편의 발병 이전 번역 중단 포함 됩니다. 규제 완화와 이러한 프로세스에서 오류가 발생할 암, 출생 결함, 또는 mitotic 세포 죽음. RO-3306 같은 Cdk1의 특정 억제제 개발된8, 기능성 연구를 위한 강력한 도구를 제공 하는 되었고 이러한 억제제 중 일부는 현재 암 치료에 대 한 임상 시험 (검토를 위해9 참조).
여기, 우리가 시험관에서 키 분석 결과 Cdk1 관련 인 산화 위치의 식별 수 있도록 설명 합니다. 이 분석 결과에서 상용 인간 Cdk1/ B는 순화 대상 단백질에서 생체 외에서phosphorylate 데 사용 됩니다. 기판의 인 산화의 질량을 증가 하 고 추가 두 음 전; 따라서, 성공적인 인 산화는 SDS 페이지에 단백질 젤 밴드의 상승 교대에 의해 확인 된다. 인 산화 Cdk1 특정 사이트 이후 체 외에 phosphorylated 단백질의 질량 분석 분석에 의해 식별 됩니다. 실험적인 디자인으로 돕기 위해 우리는 또한 계산 도구와 단백질 시퀀스에서 Cdk1 관련 인 산화 위치의 예측에 대 한 참조를 검토 합니다. 또한, 우리는 또한 매우 순수 하 고 균질 단백질 준비 니 분석 결과 대 한 적합 한 생성 하는 정화 프로토콜 설명 합니다. 마지막으로, 기능 연구에 의해 확인 된 인 산화 사이트를 확인 해야 합니다 그리고 여기에 설명 된 간단한 바인딩 분석 결과 그 목적을 위해. 결합, 이것은 매우 강력한 접근 Cdk1 세포 주기7,,1011를 제어 하는 방법으로 기계 론 적인 연구를 가능 하 게 Cdk1 관련 인 산화 사이트를 생성. 이 메서드는 순화 된 단백질에 의존, 이후 모든 모델 유기 체 및 수율 신뢰할 수 있는 결과에 적용할 수 있습니다. 그러나, 취득된 인 산화 사이트에는 생체 외에서 의 기능 확인은 권장, 셀 추가 규제 메커니즘 posttranslational 수정, 상호 파트너 또는 셀룰러 지역화 같은 장소에는 인 산화 사이트 액세스할 수 또는 Cdk1에 의해 인식에 대 한 액세스할 수 없게 렌더링 수 있습니다.
Cdk1 어디 X 어떤 잔류물 이며 떠들고 또는 트레오닌 인 산화의 사이트 (Ser/Thr-프로-X-리스/Arg), 구성 된 합의 인 산화 사이트를 인식 합니다. 특히 중요 한 인식에 대 한 + 1 위치에 프롤린의 존재가입니다. + 2 또는 3 위치에 기본적인 잔류물을 선호 하는 또한, 대부분 Cdk1 관련 인 산화 사이트는 + 3에서 리스 또는 Arg를 포함 위치6,12.
Cdk1의 활성화 긴밀 하 게 규제 하 고 유사 분열1,2,3,,45의 발병에 연결 됩니다.  종속 kinases의 활동 일반적으로 진동 세포 주기13전역 수준에서 표현 되는 뚜렷한 cyclins ( A, B, C, D, 그리고 E 인간에서), 그들의 연관에 따라 달라 집니다. Cdk1는 일정 한 세포 주기 고  A와 B5,13,,1415로  규제 소 단위와의 연결에 의존 하는 그것의 활동의 규제 뿐만 아니라 포스트 번역 상 수정. Cdk1/ B 복합체의 형성이 키 니 아 제 활성화5,14,15,,1617,18에 대 한 필요 합니다. G2 단계  B는 cytosol에서 번역 및 그것은 Cdk15,14,15,16,,1718; 바인딩 핵을 가져올 그러나, Cdk1/ B 인간 Cdk1 억제 kinases Myt1에 의해 Thr14와 Tyr15 잔류물에 인 산화 (멤브레인 관련 티로신, 트레오닌-특정 cdc2 억제 키)와 Wee1, 각각19, 사 개최 20,21. 늦은 G2 단계에서 세포 분열 주기 25 인산 가수분해 효소 (cdc25)에 의해 Thr14와 Tyr15의 dephosphorylation Cdk1/ B 복합의 키 니 아 제 활동을 활성화 하 고 유사 분열12,14, 의 개시를 유발 18 , 20 , 22 , 23. Thr161 인 산화는 Cdk1/ B 활성화에도 필요 하 고 Cdk7, Cdk 활성화 키 (케이크)18에 의해 중재입니다.  B anaphase에의 생긴다 Cdk1을, 유사 분열24,25에서 출구를 허용. Cdk1/ B의 활성화는 따라서 복잡 한 과정입니다. 여기에 제시 된 프로토콜 상용 Cdk1/ b 수행 곤충 세포에서이 복합물의 재조합 식 동안 활성화 된 vivo에서 생 kinases14,20 이며 순화 된 상태에서 활성 상태로 유지 합니다. 결과 활성화, 재조합 인간 Cdk1/ B는 생체 외에서 키 니 아 제 분석 실험에 적합 합니다.
여기, 우리는 인간의 centromere 단백질 F (CENP F)10Cdk1 관련 인 산화 위치의 식별에 대 한 프로토콜을 설명합니다. CENP-F는 대부분 interphase (g 1과 S 상)의 중 핵에 있는 g 2 단계26,27,28 , Cdk1 종속 방식으로10에 cytosol에 수출 하는 kinetochore 단백질 11. 핵 지역화26이 분 cNLS 의해 수 여. cNLSs 핵 전송 요소 karyopherin α karyopherin β 및 RanGDP, 핵29에 cNLS 화물의 수입 촉진에 의해 인식 됩니다. G2 단계에서 핵 수출10알 수 없는 수출 통로 통해 촉진 된다. CENP-F는 cytosol에 있는, 일단 핵을 모집 하 고 차례 차례로 모터 단백질 복잡 한 다30,31신병. 이 통로 mitotic 항목의 정확한 타이밍에 대 한 및 두뇌에 있는 근본적인 과정에 대 한 중요 한 다 종속 방식 mitotic 스핀 들 어셈블리의 초기 단계는 centrosome 각각 핵 위치 하는 것이 중요 하다 개발30,,3132. G 2 단계에서 시작 해 서, CENP-F 또한 조립 되는 kinetochore에 충실 한 염색체 분리27,28,,3334,35에 대 한 중요 한 역할을가지고 . 이 통로의 주요 규제 단계는 Cdk110,11에 따라 g 2 단계에서 CENP-F의 핵 수출 이다. 여기 CENP F. cNLS에 Cdk1-관련 인 산화 위치의 식별 프로토콜 설명 이 사이트의 Phosphomimetic 돌연변이 CENP-f, B Cdk1/ 직접 CENP-F의 그것의 cNLS10의 인 산화에 의해 세포 지역화 조절 제안 핵 가져오기 천천히.
전반적으로,이 생체 외에서 니 분석 결과 수 있습니다 특정 기판의 식별을 키 Cdk1 정화 대상 단백질 phosphorylated 생체 외에서 상용 Cdk1/ B 복합물 및 인 산화 사이트에 대 한 이후 질량 분석에 의해 식별 됩니다. Cdk1-특정 한 인 산화 위치의 식별 Cdk1 세포 주기를 제어 하는 방법을 계시 하는 기계 론 적인 연구를 지원 합니다.

<table>
	<tbody>
		<tr>
			<td>2800 ml baffled Fernbach flask</td>
			<td>Corning</td>
			<td>44232XL</td>
			<td></td>
		</tr>
		<tr>
			<td>ampicillin</td>
			<td>Gold Biotechnology</td>
			<td>A-301-25</td>
			<td></td>
		</tr>
		<tr>
			<td>ATP</td>
			<td>Fisher Scientfiic</td>
			<td>BP413-25</td>
			<td></td>
		</tr>
		<tr>
			<td>benzamidine hydrochloride</td>
			<td>Millipore Sigma</td>
			<td>B6506-25</td>
			<td></td>
		</tr>
		<tr>
			<td>bottletop filter</td>
			<td>Corning</td>
			<td>431161</td>
			<td></td>
		</tr>
		<tr>
			<td>Cdk1/cyclin B recombinant, human 20,000 U/mL</td>
			<td>New England Biolabs</td>
			<td>P6020</td>
			<td></td>
		</tr>
		<tr>
			<td>Cdk1/cyclin B (alternate source)</td>
			<td>EMD Millipore</td>
			<td>14-450</td>
			<td></td>
		</tr>
		<tr>
			<td>Cdk1/cyclin B (alternate source)</td>
			<td>Invitrogen</td>
			<td>PV3292</td>
			<td></td>
		</tr>
		<tr>
			<td>Cdk1/cyclin B + 10x PK buffer</td>
			<td>New England Biolabs</td>
			<td>P6020</td>
			<td></td>
		</tr>
		<tr>
			<td>CENP-F (residues 2987 &#8211; 3065) pGEX6P1 plasmid</td>
			<td>Available upon request.</td>
			<td></td>
			<td></td>
		</tr>
		<tr>
			<td>centrifuge: Heraeus Multifuge X3R, cooled, with TX-1000 swing-out rotor</td>
			<td>Thermo Scientific</td>
			<td>10033-778</td>
			<td></td>
		</tr>
		<tr>
			<td>centrifugal filter units: Amicon Ultra-15 centrifugal filter units, 3 kDa cutoff, Ultracel-PL membranes</td>
			<td>EMD Millipore</td>
			<td>UFC900324</td>
			<td></td>
		</tr>
		<tr>
			<td>chlorampenicol</td>
			<td>Gold Biotechnology</td>
			<td>C-105-100</td>
			<td></td>
		</tr>
		<tr>
			<td>D/L methionine</td>
			<td>Agros Organics / Fisher</td>
			<td>125650010</td>
			<td></td>
		</tr>
		<tr>
			<td>desalting pipet tips: Zip tips</td>
			<td>Millipore Sigma</td>
			<td>ZTC18S008</td>
			<td></td>
		</tr>
		<tr>
			<td>disposable chromatography columns, Econo-Pac 1.5 x 12 cm</td>
			<td>Biorad</td>
			<td>7321010</td>
			<td></td>
		</tr>
		<tr>
			<td>dithiothreitol</td>
			<td>Gold Biotechnology</td>
			<td>DTT50</td>
			<td></td>
		</tr>
		<tr>
			<td>E. coli Rosetta 2(DE3)pLysS strain</td>
			<td>EMD Millipore</td>
			<td>71403</td>
			<td></td>
		</tr>
		<tr>
			<td>electrospray ionization Fourier transform ion</td>
			<td>Bruker Amazon</td>
			<td>Apex III</td>
			<td></td>
		</tr>
		<tr>
			<td>cyclotron resonance mass spectrometer</td>
			<td></td>
			<td></td>
			<td></td>
		</tr>
		<tr>
			<td>electrospray ionization ion trap mass spectrometer</td>
			<td>Bruker Amazon</td>
			<td>custom</td>
			<td></td>
		</tr>
		<tr>
			<td>fixed angle rotor: Fiberlite F15-8x-50cy</td>
			<td>Thermo Scientific</td>
			<td>97040-276</td>
			<td></td>
		</tr>
		<tr>
			<td>FPLC system: &#196;kta Pure FPLC</td>
			<td>GE Healthcare</td>
			<td>29032697</td>
			<td></td>
		</tr>
		<tr>
			<td>Gel filtration column: Superdex 200 Increase 10/300 GL</td>
			<td>GE Healthcare</td>
			<td>28990944</td>
			<td></td>
		</tr>
		<tr>
			<td>glutathione agarose</td>
			<td>Pierce</td>
			<td>16101</td>
			<td></td>
		</tr>
		<tr>
			<td>glutathione, reduced</td>
			<td>Millipore Sigma</td>
			<td>G4251-50g</td>
			<td></td>
		</tr>
		<tr>
			<td>incubation shaker: multitron shaker</td>
			<td>Infors</td>
			<td>I10102</td>
			<td></td>
		</tr>
		<tr>
			<td>isopropyl &#946;-D-1-thiogalactopyranoside</td>
			<td>Gold Biotechnology</td>
			<td>I2481C50</td>
			<td></td>
		</tr>
		<tr>
			<td>kanamycin</td>
			<td>Gold Biotechnology</td>
			<td>K-120-25</td>
			<td></td>
		</tr>
		<tr>
			<td>karyopherin &#945; pet-28a pres plasmid</td>
			<td>Available upon request.</td>
			<td></td>
			<td></td>
		</tr>
		<tr>
			<td>Luria Bertani medium</td>
			<td>Fisher Scientfiic</td>
			<td>BP1426-2</td>
			<td></td>
		</tr>
		<tr>
			<td>microcentrifuge 5418R, refrigerated</td>
			<td>Eppendorf</td>
			<td>5401000013</td>
			<td></td>
		</tr>
		<tr>
			<td>microtubes (0.5 ml)</td>
			<td>Eppendorf</td>
			<td>30121023</td>
			<td></td>
		</tr>
		<tr>
			<td>microtubes (1.5 ml)</td>
			<td>Eppendorf</td>
			<td>30120086</td>
			<td></td>
		</tr>
		<tr>
			<td>Nickel affinity gel: His-Select Nickel affinity gel</td>
			<td>Millipore Sigma</td>
			<td>P6611-100ml</td>
			<td></td>
		</tr>
		<tr>
			<td>pGEX-6P-1 plasmid</td>
			<td>Millipore Sigma</td>
			<td>GE28-9546-48</td>
			<td></td>
		</tr>
		<tr>
			<td>phenylmethylsulfonyl fluoride</td>
			<td>Gold Biotechnology</td>
			<td>P470-10</td>
			<td></td>
		</tr>
		<tr>
			<td>PS protease: PreScission protease</td>
			<td>GE Healthcare</td>
			<td>27084301</td>
			<td></td>
		</tr>
		<tr>
			<td>Phos-tag acrylamide</td>
			<td>Wako Pure Chem. Ind.</td>
			<td>304-93521</td>
			<td></td>
		</tr>
		<tr>
			<td>reduced gluthathione</td>
			<td>Millipore Sigma</td>
			<td>G4251-50g</td>
			<td></td>
		</tr>
		<tr>
			<td>roundbottom centrifuge tubes (Oakridge tubes)</td>
			<td>Fisher Scientfiic</td>
			<td>055291D</td>
			<td></td>
		</tr>
		<tr>
			<td>site-directed mutagenesis kit: QuikChange Lightning</td>
			<td>Agilent</td>
			<td>210518</td>
			<td></td>
		</tr>
		<tr>
			<td>Site-Directed Mutagenesis Kit</td>
			<td></td>
			<td></td>
			<td></td>
		</tr>
		<tr>
			<td>sonifier: Branson S-250D sonifier</td>
			<td>Branson</td>
			<td>15 338 125</td>
			<td></td>
		</tr>
		<tr>
			<td>Spectra/Por 1RC dialysis membrane (6-8 kDa cutoff)</td>
			<td>Spectrum Labs</td>
			<td>08 670B</td>
			<td></td>
		</tr>
		<tr>
			<td>swing out rotor TX-1000</td>
			<td>Thermo Scientific</td>
			<td>10033-778</td>
			<td></td>
		</tr>
	</tbody>
</table>

identification of cyclin-dependent kinase 1 specific phosphorylation sites by an in vitro kinase assay

 종속 키 1 (Cdk1)는 모든 진핵생물의 세포 주기 위한 마스터 컨트롤러와 프로테옴;의 약된 8-13% phosphorylates 그러나, Cdk1, 특히 인간의 세포에에서 대 한 확인된 대상 수 여전히 낮습니다. Cdk1-특정 한 인 산화 위치의 식별 중요 하다, 그들은 Cdk1 세포 주기를 제어 하는 방법에 대 한 기계적 통찰력을 제공. 세포 주기 규칙 충실 한 염색체 분리에 대 한 중요 하 고이 복잡 한 과정에 결함 염색체 착오 및 암으로 이어질.
여기, 우리가 시험관에서 키 분석 결과 Cdk1 관련 인 산화 위치를 식별 하는 데 사용 되는 설명 합니다. 이 분석 결과, 순화 된 단백질은 phosphorylated 생체 외에서 상용 인간 Cdk1/ B. 성공에 의해 인 산화 SDS 페이지에서 확인 및 인 산화 사이트 이후 질량 분석에 의해 식별 됩니다. 우리는 또한 정화 프로토콜 간의 상호 작용을 조사 확인 된 인 산화 위치의 기능 검증에 대 한 키 니 아 제 분석 실험 및 바인딩 분석 결과 대 한 적합 한 매우 순수 하 고 균질 단백질 준비 항복을 설명합니다 클래식 핵 지 방화 신호 (cNLS) 그리고 그것의 핵 수송 수용 체 karyopherin α. 실험 설계와 투입, 단백질 시퀀스에서 Cdk1 관련 인 산화 위치의 예측에 대 한 접근 방법을 검토 합니다. 함께 이러한 프로토콜 Cdk1 전용 인 산화 사이트를 생성 하 고 Cdk1 세포 주기를 제어 하는 방법으로 기계 론 적인 연구는 매우 강력한 접근 방식을 제공 합니다. 때문에이 메서드는 순화 된 단백질에 의존, 그것은 적용할 수 있습니다 어떤 모델 유기 체 및 수율 신뢰할 수 있는 결과에, 세포 기능 연구와 결합 하는 경우에 특히.

최근 포함 cNLS10CENP-F 조각에서 Cdk1 관련 인 산화 사이트를 식별 하는 생체 외에서 니 분석 결과 (그림 1) 사용 했습니다. 이 신호는 대부분의 interphase 동안 CENP F의 핵 지역화를 수 여. G2 단계에서 CENP F Cdk1 종속 방식에서 cytosol에 핵에서 수출 된다. Cdk1 CENP-F의 셀룰러 지역화를 조절 하는 방법에 대 한 기계적 통찰력을 얻으려면, 우리는 iGPS 서버36,37을 사용 하 여 CENP-F Cdk1-관련 인 산화 위치를 예측 하기의 순서 분석. CENP F cNLS, 내 세 Cdk1 관련 인 산화 사이트 예측 했다 3,042, 잔류물에서 3045, 및 3,048 (표 1). 또 다른 Cdk1 인 산화의 사이트 또한 잔류물 3,007 (표 1)10에 대 한 예언 되었다. 따라서, 우리는 Cdk1의 cNLS의 인 산화에 의해 직접 CENP F 지역화 조절 가설.
16%에 CENP F cNLS는 Cdk1에 대 한 기판, 순화 된 인간의 CENP F fragment (잔류물 2,987-3065)로 체 외에 니 시험 수행 및 인간 Cdk1/ B. 생체 외에서 CENP F phosphorylated 여부를 테스트 하려면 분석 SDS 페이지 키 니 아 제 Cdk1 부족 부정적인 컨트롤과 함께 (그림 2A)10. 생체 외에서 CENP F phosphorylated, 대 한 부정적인 컨트롤에 비해 젤에 밴드에 대 한 명확한 상승 변화 관찰 됩니다. 이것은 phosphorylated 단백질의 전형적인 두 부정적인 요금 및 추가 대량 추가 하는 각 인산 염 그룹입니다. 이러한 결과 CENP F Cdk1/ B10phosphorylated는 건의 한다.
CENP-F 인 산화 위치의 수를 결정 하 고이 사이트의 인 산화 효율 척도를 그대로 체 외에 phosphorylated CENP F 조각 (84-메 르) 질량 분석 (ESI-ITMS)10에 의해 분석 되었다. 관찰 된 ESI 이온 트랩 질량 스펙트럼 (그림 2B) 그대로 CENP F 조각 4 개의 사이트 (표 1)10에 phosphorylated은 나왔다.
CENP-F의 순서에 phosphorylated 아미노산 사이트의 위치에 의해 평가 되었다 lysines 및 arginines, 후 단백질 사슬을 고대의 ESI FTICR 양 트립 신에 의해 tryptic 요약을 검토 하 고 CENP F 파편의 트립 신 다이제스트 결과 여러 펩타이드, 3,031-3, 052 잔류물을 포함 하는 것을 포함 하 여 이 CENP F 펩 티 드의 질량 스펙트럼 잔류물 T3042, T3045, 및 S3048, cNLS (표 1)10있는에 인 산화와 일치 했다. 또 다른 tryptic 펩 티 드 (잔류물 2995-3,016)의 질량 스펙트럼에 S3007 인 산화와 일치 했다 (표 1)10. 모든 4 개의 Cdk1-관련 인 산화 사이트 또한 시퀀스에서 예측 했다. Cdk1 전용 기판 종종 포함 옆에 phosphorylated6, 잔류물 프롤린 잔류물 T3042, T3045, 및 S3007에 대 한 관찰. 그것은 주목 해야한다 S3048는 다소 특이 한 Cdk1 관련 인 산화 사이트는 페닐알라닌 옆에서 떠들고 있는. 결론, 결과 CENP-F 키 Cdk1에 의해 잔류물 3,007, 3,042, 3,045, 및 3,048에서 특히 phosphorylated는 것이 좋습니다. 이러한 잔류물의 3 CENP-F (표 1), Cdk1 CENP F Cdk1 때 활성10g 2 단계에는 cNLS의 인 산화를 통해 셀룰러 지역화를 조절 수 있습니다 나타내는의 cNLS 안에 있습니다.
이 Cdk1 관련 인 산화 위치는 생리 기능을 확인 하려면 phosphomimetic 변형 S3048D10만들었습니다. Phosphomimetic 돌연변이 부정적으로 위탁 된 잔류물에 의해 인 산화의 효과 모방. 다음으로, 우리는 cNLS 포함 CENP F 조각의 phosphomimetic 버전 정화. CENP F cNLS 핵 수송 수용 체 karyopherin α, 높은 선호도와 바인딩하고 CENP f. 핵 가져올 필요는 의해 인식 된다 Phosphomimetic 돌연변이 핵 수송 수용 체 karyopherin α와 CENP f cNLS 사이 상호 작용을 약화 하는 여부를 테스트 하려면 우리 수행 바인딩 분석 결과 (그림 3)10. 이 실험에서 순화 CENP F 조각 (야생-타입 또는 S3048D 이체) 순화 된 인간의 karyopherin α와 함께 혼합 했다 고 혼합물 분석 크기 배제 크로마토그래피에 의해 분리 되었다. 더하여, 단백질은 개별적으로 분석 또한 되었다. 차입 분수의 SDS 페이지 분석이 밝혔다 그는 cNLS와 야생-타입 CENP F 조각 강하게 상호 작용 karyopherin α, 이후 두 단백질 공동 elute (그림 3)10. 그러나, 무시할 수 양의 CENP F S3048D 조각 karyopherin α를 한다이 단백질 elute 별도로 (그림 3)10. 이러한 결과 인 산화 제안 잔류물의 CENP F cNLS의 3,048 핵 전송 요소 karyopherin α와의 상호 작용에 강한 영향을 했. 그것은 핵 가져오기 요금은 높은 핵 전송 요소46, 향해 핵 지 방화 신호의 선호도에 따라 그리고 그러므로, 이러한 돌연변이 핵 가져오기10천천히 예상 된다 주목 해야한다.
<img alt="Figure 1" class="xfigimg" src="/files/ftp_upload/57674/57674fig1.jpg"> 그림 1: 니 분석 결과 생체 외에서 Cdk1의 도식 대표. <a href="/files/ftp_upload/57674/57674fig1large.jpg" target="_blank">이 그림의 더 큰 버전을 보려면 여기를 클릭 하십시오.</a>
<img alt="Figure 2" class="xfigimg" src="/files/ftp_upload/57674/57674fig2.jpg"> 그림 2: CENP F Cdk1/ b. phosphorylated (A) Cdk1 인 산화 특정 사이트, 생체 외에서 키 니 아 제 분석 실험을 수행한 정화 CENP-F (잔류물 2,987-3065)로 확인. SDS 페이지 분석 Cdk1/ B 없이 부정적인 컨트롤의 왼쪽된 차선에서 표시 됩니다 (-Cdk1), 옆에 오른쪽 차선 (+ Cdk1) CENP-F phosphorylated 생체 외에서 . 분자 무게 기준은 표시 됩니다. SDS 페이지에 phosphorylated CENP-F의 상승 교대 note는 성공적인 인 산화와 일치. Cdk1 및  B 34 kDa과 60 kDa에 희미 한 밴드로 표시 됩니다. (B) 그대로 phosphorylated CENP-F (A)에서 ESI 이온 트랩 질량 분석 그대로 phosphorylated CENP-F (84-메 르)의 인산 염 부하를 결정 하는 데 사용 되었다. 해당 질량 스펙트럼 표시 됩니다. 강도 질량 대 전 비 (m/z) 대 플롯 됩니다. 스펙트럼 인 산화 후 그대로 CENP F 조각의 14 충전 상태에 + 10을 표시합니다. 그들은 종 인구 0, 1, 2, 3, 4 인산 염 에스테 르를 나타냅니다. 각각의 종족의 총 단백질 금액 비율 계량, 피크 높이 결정 하 고 비교 (표 1). 이 그림10 에서 수정 되었습니다 그리고 테일러 및 프란시스 게시자에 의해 허가로 재현 됐다. <a href="/files/ftp_upload/57674/57674fig2large.jpg" target="_blank">이 그림의 더 큰 버전을 보려면 여기를 클릭 하십시오.</a>
<img alt="Figure 3" class="xfigimg" src="/files/ftp_upload/57674/57674fig3.jpg"> 그림 3: 기능 검증: CENP f phosphomimetic 돌연변이 강하게 핵 수송 수용 체 karyopherin α와의 상호 작용 감소. (A-F) CENP-F 조각 (잔류물 2,987-3065) 정화 (0.1 mg) 및 정화 karyopherin α (0.7 mg)와 1:1 어 금 니 비율에 혼합 되었고 크기 배제 크로마토그래피에 의해 분석. CENP-F 조각과 karyopherin α도 개별적으로 분석 했다. 피크 분수의 SDS 페이지 분석 표시 됩니다. 차입 볼륨 (0.6 mL 단위로) 하단에 표시 됩니다. 왼쪽에, kDa 분자량 마커 밴드와 그들의 질량의 위치가 표시 됩니다. 별표는 잔여 GST (glutathione S-전이 효소)의 흔적을 표시합니다. (A) 프로필 Karyopherin α. (B) 차입. 280에서 흡 광도 nm 차입 볼륨 대 그려집니다. Karyopherin α (빨간색)에 대 한 차입 프로필 karyopherin α CENP F 파편의 혼합물의 차입 프로필 중첩 (야생-타입: 녹색; phosphomimetic S3048D 돌연변이: 블루). 야생-타입 CENP F 조각의 추가와 CENP F 야생-타입 파편의 바인딩 일치 하는 높은 질량에 karyopherin α 피크의 차입 볼륨 이동 note. Phosphomimetic 돌연변이 karyopherin α. (C) CENP-F 야생-타입 조각 (wt)와 CENP-F의 상호 작용을 크게 감소 한다 제안으로 phosphomimetic 돌연변이 S3048D와 CENP-F 조각 추가 될 때이 변화 하지 관찰 및 karyopherin α. (D) CENP-F wt 단편입니다. (E) CENP F S3048D 조각 및 karyopherin α. (F) CENP F S3048D 조각화. 이 그림10에서 데이터를 만들었습니다. <a href="/files/ftp_upload/57674/57674fig3large.jpg" target="_blank">이 그림의 더 큰 버전을 보려면 여기를 클릭 하십시오.</a>
<table border="1" fo:keep-together.within-page="1" fo:keep-with-next.within-page="always"><tbody>
<tr>
<td colspan="3">테이블 1A입니다. 조각의 CENP F (잔류물 2987-3065)와 시퀀스 예측 Cdk1 전용 인 산화 사이트를 더 큰 글꼴 크기에 의해 강조 했다. Tryptic 파편은 굵게 강조 표시 하 고 밑줄.</td>
		</tr>
<tr>
<td colspan="3">GPLGSQQSKQDSRGSPLLGPVVPGPSPIPSVTEKRLSSGQNKAS</td>
		</tr>
<tr>
<td colspan="3">GKRQRSSGIWENGGGPTPATPESFSKKSKKAVMSGIHPAE</td>
		</tr>
<tr>
<td colspan="3">표 1B입니다. 그대로 CENP F의 질량 분석 분석</td>
		</tr>
<tr>
<td colspan="3">생체 외에서 인 산화 Cdk1/ b 후 84 메 르</td>
		</tr>
<tr>
<td></td>
			<td>위치의 인 산화 (P) 감지 #</td>
			<td>인산 염 부하 총 단백질의 %로 표시</td>
		</tr>
<tr>
<td rowspan="5">CENP-F 2987-3065</td>
			<td>0 P</td>
			<td>6%</td>
		</tr>
<tr>
<td>1 P</td>
			<td>37%</td>
		</tr>
<tr>
<td>2 P</td>
			<td>40%</td>
		</tr>
<tr>
<td>3 P</td>
			<td>15%</td>
		</tr>
<tr>
<td>4 P</td>
			<td>3%</td>
		</tr>
<tr>
<td colspan="3">테이블 1C. 후에 생체 외에서 인 산화 Cdk1/ b CENP F의 tryptic 펩 티 드의 질량 분석 분석</td>
		</tr>
<tr>
<td></td>
			<td>인 산화 위치의 #</td>
			<td>인산 염 부하</td>
		</tr>
<tr>
<td>Tryptic phosphopeptide</td>
			<td>0 P</td>
			<td>57%</td>
		</tr>
<tr>
<td>잔류물 2995-3016</td>
			<td>1 P</td>
			<td>43%</td>
		</tr>
<tr>
<td>Tryptic phosphopeptide</td>
			<td>0 P</td>
			<td>7%</td>
		</tr>
<tr>
<td>잔류물 3031-3052</td>
			<td>1 P</td>
			<td>64%</td>
		</tr>
<tr>
<td></td>
			<td>2 P</td>
			<td>29%</td>
		</tr>
<tr>
<td></td>
			<td>3 P</td>
			<td>1%</td>
		</tr>
</tbody></table>표 1: 체 외에 인 산화 Cdk1/ b 후 분석 분석 CENP F 조각의 질량 이 테이블 데이터10를 만들었습니다.

Watch this Scientific Journal Video about Identification of Cyclin-dependent Kinase 1 Specific Phosphorylation Sites by an In Vitro Kinase Assay at JoVE.com

Identification of Cyclin-dependent Kinase 1 Specific Phosphorylation Sites by an In Vitro Kinase Assay

 종속 키 1 (Cdk1) 세포 주기의 g 2 단계에서 활성화 되 고 많은 세포 경로 조절. 여기, Cdk1, Cdk1-특정 한 인 산화 위치의 식별이 중요 한 키의 셀룰러 목표 설정에 대 한 수와 함께 체 외에 니 분석 결과 대 한 프로토콜 선물이.

 종속 키 1의 시험관에서 키에 의해 인 산화 특정 사이트 분석 결과

Cyclin-dependent kinase 1 (Cdk1) is a master controller for the cell cycle in all eukaryotes and phosphorylates an estimated 8 - 13% of the proteome; ...

identification-cyclin-dependent-kinase-1-specific-phosphorylation

Nanyang Technological University

Research

JoVE Journal

Biochemistry

Identification of Cyclin-dependent Kinase 1 Specific Phosphorylation Sites by an In Vitro Kinase Assay

18.4K 조회수.  State University of New York at Binghamton.  종속 키 1 (Cdk1) 세포 주기의 g 2 단계에서 활성화 되 고 많은 세포 경로 조절. 여기, Cdk1, Cdk1-특정 한 인 산화 위치의 식별이 중요 한 키의 셀룰러 목표 설정에 대 한 수와 함께 체 외에 니 분석 결과 대 한 프로토콜 선물이.

비디오: Identification of Cyclin-dependent Kinase 1 Specific Phosphorylation Sites by an In Vitro Kinase Assay

Quantification of Bacterial Histidine Kinase Autophosphorylation Using a Nitrocellulose Binding Assay

We demonstrate a useful method for quantifying autophosphorylation of purified bacterial histidine kinases. Histidine kinases are known for their involvement in two-component signal transduction, a ubiquitous system through which bacteria sense and respond to environmental stimuli. Two-component signaling features autophosphorylation of a histidine kinase, followed by phosphotransfer to the receiver domain of a response regulator protein, which ultimately leads to an output response. Autophosphorylation of the histidine kinase is responsive to the presence of a cognate environmental stimulus, thereby giving bacteria a means to detect and respond to changes in the environment. Despite their importance in bacterial biology, histidine kinases remain poorly understood due to the inherent lability of phosphohistidine. Conventional methods for studying these proteins, such as SDS-PAGE autoradiography, have significant shortcomings. We have developed a nitrocellulose binding assay that can be used to characterize histidine kinases. The protocol for this assay is simple and easy to execute. Our method is higher throughput, less time-consuming, and offers a greater dynamic range than SDS-PAGE autoradiography.

We report and demonstrate an optimized nitrocellulose binding assay that can be used to quantify autophosphorylation of purified bacterial histidine kinases. Our method has several advantages over traditional SDS-PAGE based techniques, providing a valuable alternative for characterizing these important proteins.

니트로 셀룰로오스 결합 분석을 사용하여 세균 히스티딘 키나제자가 인산화의 정량

We demonstrate a useful method for quantifying autophosphorylation of purified bacterial histidine kinases. Histidine kinases are known for their ...

연구

생화학

Assaying Protein Kinase Activity with Radiolabeled ATP

Protein kinases are able to govern large-scale cellular changes in response to complex arrays of stimuli, and much effort has been directed at uncovering allosteric details of their regulation. Kinases comprise signaling networks whose defects are often hallmarks of multiple forms of cancer and related diseases, making an assay platform amenable to manipulation of upstream regulatory factors and validation of reaction requirements critical in the search for improved therapeutics. Here, we describe a basic kinase assay that can be easily adapted to suit specific experimental questions including but not limited to testing the effects of biochemical and pharmacological agents, genetic manipulations such as mutation and deletion, as well as cell culture conditions and treatments to probe cell signaling mechanisms. This assay utilizes radiolabeled [&#947;-32P] ATP, which allows for quantitative comparisons and clear visualization of results, and can be modified for use with immunoprecipitated or recombinant kinase, specific or typified substrates, all over a wide range of reaction conditions.

Protein kinases are highly evolved signaling enzymes and scaffolds that are critical for inter- and intracellular signal transduction. We present a protocol for measuring kinase activity through the use of radiolabeled adenosine triphosphate ([&#947;-32P] ATP), a reliable method to aid in elucidation of cellular signaling regulation.

방사성 표지 된 ATP로 단백질 키나아제 활성 측정

Protein kinases are able to govern large-scale cellular changes in response to complex arrays of stimuli, and much effort has been directed at uncovering ...

Oligopeptide Competition Assay for Phosphorylation Site Determination

Protein phosphorylation at specific sites determines its conformation and interaction with other molecules. Thus, protein phosphorylation affects biological functions and characteristics of the cell. Currently, the most common method for discovering phosphorylation sites is by liquid chromatography/mass spectrometry (LC/MS) analysis, a rapid and sensitive method. However, relatively labile phosphate moieties are often released from phosphopeptides during the fragmentation step, which often yields false-negative signals. In such cases, a traditional in vitro kinase assay using site-directed mutants would be more accurate, but this method is laborious and time-consuming. Therefore, an alternative method using peptide competition may be advantageous. The consensus recognition motif of 5&#39; adenosine monophosphate-activated protein kinase (AMPK) has been established1 and was validated using a positional scanning peptide library assay2. Thus, AMPK phosphorylation sites for a novel substrate could be predicted and confirmed by the peptide competition assays. In this report, we describe the detailed steps and procedures for the in vitro oligopeptide-competing kinase assay by illustrating AMPK-mediated nuclear factor erythroid 2-related factor 2 (Nrf2) phosphorylation. To authenticate the phosphorylation site, we carried out a sequential in vitro kinase assay using a site-specific mutant. Overall, the peptide competition assay provides a method to screen multiple potential phosphorylation sites and to identify sites for validation by the phosphorylation site mutants.

Peptide competition assays are widely used in a variety of molecular and immunological experiments. This paper describes a detailed method for an in vitro oligopeptide-competing kinase assay and the associated validation procedures, which may be useful to find specific phosphorylation sites.

인산화 부위 결정을위한 올리고 펩타이드 경쟁 분석

Protein phosphorylation at specific sites determines its conformation and interaction with other molecules. Thus, protein phosphorylation affects ...

An In Vitro Assay to Detect tRNA-Isopentenyl Transferase Activity

N6-isopentenyladenosine RNA modifications are functionally diverse and highly conserved among prokaryotes and eukaryotes. One of the most highly conserved N6-isopentenyladenosine modifications occurs at the A37 position in a subset of tRNAs. This modification improves translation efficiency and fidelity by increasing the affinity of the tRNA for the ribosome. Mutation of enzymes responsible for this modification in eukaryotes are associated with several disease states, including mitochondrial dysfunction and cancer. Therefore, understanding the substrate specificity and biochemical activities of these enzymes is important for understanding of normal and pathologic eukaryotic biology. A diverse array of methods has been employed to characterize i6A modifications. Herein is described a direct approach for the detection of isopentenylation by Mod5. This method utilizes incubation of RNAs with a recombinant isopentenyl transferase, followed by RNase T1 digestion, and 1-dimensional gel electrophoresis analysis to detect i6A modifications. In addition, the potential adaptability of this protocol to characterize other RNA-modifying enzymes is discussed.

An In Vitro Assay to Detect tRNA-Isopentenyl Transferase Activity

Here, we describe a protocol for the biochemical characterization of the yeast RNA-modifying enzyme, Mod5, and discuss how this protocol could be applied to other RNA-modifying enzymes.

TRNA Isopentenyl 전이 효소 활동을 감지 하는 체 외에서 분석 결과

N6-isopentenyladenosine RNA modifications are functionally diverse and highly conserved among prokaryotes and eukaryotes. One of the most highly conserved ...

Human Peripheral Blood Neutrophil Isolation for Interrogating the Parkinson's Associated LRRK2 Kinase Pathway by Assessing Rab10 Phosphorylation

The leucine rich repeat kinase 2 (LRRK2) is the most frequently mutated gene in hereditary Parkinson&#8217; disease (PD) and all pathogenic LRRK2 mutations result in hyperactivation of its kinase function. Here, we describe an easy and robust assay to quantify LRRK2 kinase pathway activity in human peripheral blood neutrophils by measuring LRRK2-controlled phosphorylation of one of its physiological substrates, Rab10 at threonine 73. The immunoblotting analysis described requires a fully selective and phosphospecific antibody that recognizes the Rab10 Thr73 epitope phosphorylated by LRRK2, such as the MJFF-pRab10 rabbit monoclonal antibody. It uses human peripheral blood neutrophils, because peripheral blood is easily accessible and neutrophils are an abundant and homogenous constituent. Importantly, neutrophils express relatively high levels of both LRRK2 and Rab10. A potential drawback of neutrophils is their high intrinsic serine protease activity, which necessitates the use of very potent protease inhibitors such as the organophosphorus neurotoxin diisopropylfluorophosphate (DIFP) as part of the lysis buffer. Nevertheless, neutrophils are a valuable resource for research into LRRK2 kinase pathway activity in vivo and should be considered for inclusion into PD biorepository collections.

Mutations in the leucine rich repeat kinase 2 gene (LRRK2) cause hereditary Parkinson&#8217;s disease. We have developed an easy and robust method for assessing LRRK2-controlled phosphorylation of Rab10 in human peripheral blood neutrophils. This may help identify individuals with increased LRRK2 kinase pathway activity.

Rab10 인산화를 평가하여 파킨슨병 관련 LRRK2 키나아제 경로를 심문하기 위한 인간 말초 혈액 호중구 격리

The leucine rich repeat kinase 2 (LRRK2) is the most frequently mutated gene in hereditary Parkinson&#8217; disease (PD) and all pathogenic LRRK2 ...

Identification of Novel CK2 Kinase Substrates Using a Versatile Biochemical Approach

The study of kinase-substrate relationships is essential to gain a complete understanding of the functions of these enzymes and their downstream targets in both physiological and pathological states. CK2 is an evolutionarily conserved serine/threonine kinase with a growing list of hundreds of substrates involved in multiple cellular processes. Due to its pleiotropic properties, identifying and characterizing a comprehensive set of CK2 substrates has been particularly challenging and remains a hurdle in the study of this important enzyme. To address this challenge, we have devised a versatile experimental strategy that enables the targeted enrichment and identification of putative CK2 substrates. This protocol takes advantage of the unique dual co-substrate specificity of CK2 allowing for specific thiophosphorylation of its substrates in a cell or tissue lysate. These substrate proteins are subsequently alkylated, immunoprecipitated, and identified by liquid chromatography/tandem mass spectrometry (LC-MS/MS). We have previously used this approach to successfully identify CK2 substrates from Drosophila ovaries and here we extend the application of this protocol to human glioblastoma cells, illustrating the adaptability of this method to investigate the biological roles of this kinase in various model organisms and experimental systems.

The objective of this protocol is to label, enrich, and identify substrates of protein kinase CK2 from a complex biological sample such as a cell lysate or tissue homogenate. This method leverages unique aspects of CK2 biology for this purpose.

다양 한 생 화 확 적인 접근을 사용 하 여 소설 CK2 키 기판의 식별

The study of kinase-substrate relationships is essential to gain a complete understanding of the functions of these enzymes and their downstream targets ...

Studying RNA Interactors of Protein Kinase RNA-Activated during the Mammalian Cell Cycle

Protein kinase RNA-activated (PKR) is a member of the innate immune response proteins and recognizes the double-stranded secondary structure of viral RNAs. When bound to viral double-stranded RNAs (dsRNAs), PKR undergoes dimerization and subsequent autophosphorylation. Phosphorylated PKR (pPKR) becomes active and induces phosphorylation of the alpha subunit of eukaryotic initiation factor 2 (eIF2&#945;) to suppress global translation. Increasing evidence suggests that PKR can be activated under physiological conditions such as during the cell cycle or under various stress conditions without infection. However, our understanding of the RNA activators of PKR is limited due to the lack of a standardized experimental method to capture and analyze PKR-interacting dsRNAs. Here, we present an experimental protocol to specifically enrich and analyze PKR bound RNAs during the cell cycle using HeLa cells. We utilize the efficient crosslinking activity of formaldehyde to fix PKR-RNA complexes and isolate them via immunoprecipitation. PKR co-immunoprecipitated RNAs can then be further processed to generate a high-throughput sequencing library. One major class of PKR-interacting cellular dsRNAs is mitochondrial RNAs (mtRNAs), which can exist as intermolecular dsRNAs through complementary interaction between the heavy-strand and the light-strand RNAs. To study the strandedness of these duplex mtRNAs, we also present a protocol for strand-specific qRT-PCR. Our protocol is optimized for the analysis of PKR-bound RNAs, but it can be easily modified to study cellular dsRNAs or RNA-interactors of other dsRNA binding proteins.

We present experimental approaches for studying RNA-interactors of double-stranded RNA binding protein kinase RNA-activated (PKR) during the mammalian cell cycle using HeLa cells. This method utilizes formaldehyde to crosslink RNA-PKR complexes and immunoprecipitation to enrich PKR-bound RNAs. These RNAs can be further analyzed through high-throughput sequencing or qRT-PCR.

공부 하는 단백질 키 니 아 제 RNA 포유류 세포 주기 동안 활성의 RNA 인터

Protein kinase RNA-activated (PKR) is a member of the innate immune response proteins and recognizes the double-stranded secondary structure of viral ...

Enhancing the Engraftment of Human Induced Pluripotent Stem Cell-derived Cardiomyocytes via a Transient Inhibition of Rho Kinase Activity

A crucial factor in improving cellular therapy effectiveness for myocardial regeneration is to safely and efficiently increase the cell engraftment rate. Y-27632 is a highly potent inhibitor of Rho-associated, coiled-coil-containing protein kinase (RhoA/ROCK) and is used to prevent dissociation-induced cell apoptosis (anoikis). We demonstrate that Y-27632 pretreatment for human induced pluripotent stem cell-derived cardiomyocytes (hiPSC-CMs+RI) prior to implantation results in a cell engraftment rate improvement in a mouse model of acute myocardial infarction (MI). Here, we describe a complete procedure of hiPSC-CMs differentiation, purification, and cell pretreatment with Y-27632, as well as the resulting cell contraction, calcium transient measurements, and transplantation into mouse MI models. The proposed method provides a simple, safe, effective, and low-cost method which significantly increases the cell engraftment rate. This method cannot only be used in conjunction with other methods to further enhance the cell transplantation efficiency but also provides a favorable basis for the study of the mechanisms of other cardiac diseases.

In this protocol, we demonstrate and elaborate on how to use human induced pluripotent stem cells for cardiomyocyte differentiation and purification, and further, on how to improve its transplantation efficiency with Rho-associated protein kinase inhibitor pretreatment in a mouse myocardial infarction model.

로 키나아제 활성의 일시적인 억제를 통해 인간 유도 만능 줄기 세포 유래 심근 세포의 생착을 강화

A crucial factor in improving cellular therapy effectiveness for myocardial regeneration is to safely and efficiently increase the cell engraftment rate. ...

Characterization at the Molecular Level using Robust Biochemical Approaches of a New Kinase Protein

Extensive whole genome sequencing has identified many Open Reading Frames (ORFs) providing many potential proteins. These proteins may have important roles for the cell and may unravel new cellular processes. Among proteins, kinases are major actors as they belong to cell signaling pathways and have the ability to switch on or off many processes crucial to the fate of the cell, such as cell growth, division, differentiation, motility, and death.
In this study, we focused on a new potential kinase protein, LIMK2-1. We demonstrated its existence by Western Blot using a specific antibody. We evaluated its interaction with an upstream regulating protein using coimmunoprecipitation experiments. Coimmunoprecipitation is a very powerful technique able to detect the interaction between two target proteins. It may also be used to detect new partners of a bait protein. The bait protein may be purified either via a tag engineered to its sequence or via an antibody specifically targeting it. These protein complexes may then be separated by SDS-PAGE (Sodium Dodecyl Sulfate PolyAcrylamide Gel) and identified using mass spectrometry. Immunoprecipitated LIMK2-1 was also used to test its kinase activity in vitro by &#947;[32P] ATP labeling. This well-established assay may use many different substrates, and mutated versions of the bait may be used to assess the role of specific residues. The effects of pharmacological agents may also be evaluated since this technique is both highly sensitive and quantitative. Nonetheless, radioactivity handling requires particular caution. Kinase activity may also be assessed with specific antibodies targeting the phospho group of the modified amino acid. These kinds of antibodies are not commercially available for all the phospho modified residues.

We characterized a new kinase protein using robust biochemical approaches: Western Blot analysis with a dedicated specific antibody on different cell lines and tissues, interactions by coimmunoprecipitation experiments, kinase activity detected by Western Blot using a phospho-specific antibody and by &#947;[32P] ATP labeling.

새로운 키나제 단백질의 강력한 생화학 적 접근법을 사용하여 분자 수준에서특성화

Extensive whole genome sequencing has identified many Open Reading Frames (ORFs) providing many potential proteins. These proteins may have important ...

Kinase Inhibitor Screening In Self-assembled Human Protein Microarrays

The screening of kinase inhibitors is crucial for better understanding properties of a drug and for the identification of potentially new targets with clinical implications. Several methodologies have been reported to accomplish such screening. However, each has its own limitations (e.g., the screening of only ATP analogues, restriction to using purified kinase domains, significant costs associated with testing more than a few kinases at a time, and lack of flexibility in screening protein kinases with novel mutations). Here, a new protocol that overcomes some of these limitations and can be used for the unbiased screening of kinase inhibitors is presented. A strength of this method is its ability to compare the activity of kinase inhibitors across multiple proteins, either between different kinases or different variants of the same kinase. Self-assembled protein microarrays generated through the expression of protein kinases by a human-based in vitro transcription and translation system (IVTT) are employed. The proteins displayed on the microarray are active, allowing for measurement of the effects of kinase inhibitors. The following procedure describes the protocol steps in detail, from the microarray generation and screening to the data analysis.

A detailed protocol for the generation of self-assembled human protein microarrays for the screening of kinase inhibitors is presented.

자체 조립된 인간 단백질 마이크로어레이에서 키나제 억제제 스크리닝

The screening of kinase inhibitors is crucial for better understanding properties of a drug and for the identification of potentially new targets with ...