Este trabajo fue financiado por los NIH (AI119813), la puesta en marcha de la Universidad de Arkansas y el premio del Instituto de biociencias de Arkansas.

1. dirigida mutagénesis Gene de la blanco
Nota: MDH se expresa bajo el promotor de T7 en el vector de pCDF-1 con el origen de CloDF13 y un número de copia de 20 a 4034.
<ol><li>Introducir el codón ámbar en la posición 140 en el gene de cartillas (adelante cartilla: GGTGTTTATGACetiquetaAACAAACTGTTCGGCG y revertir la cartilla: GGCTTTTTTCAGCACTTCAGCAGCAATTGC), siguiendo las instrucciones del kit de mutagénesis sitio-dirigida.</li>
	<li>Amplificar el plásmido de plantilla que contiene el gen de la dehidratasa del malato de tipo salvaje e inserte la mutación del codón de parada por la reacción de polimerasa (PCR) reacción en cadena. En la mezcla de reacción, son 12,5 μl de mezcla de enzima de polimerasa de ADN X 2, 1.25 μl de primer avance de 10 μm, 1,25 μl de cebador inverso de 10 μm, 1 μl de ADN de plantilla (20 ng/μL) (pCDF-1 plásmido que contiene el gen de tipo salvaje MDH) y 9 μl de agua libre de nucleasa.<ol>
<li>Utilizar parámetros de reacción de polimerización en cadena del siguiente modo: inicial de desnaturalización a 98 ° C por 30 s; 25 ciclos de 10 s a 98 ° C, 30 s a 55 ° C y a 3 min a 72 ° C; extensión final a 72 ° C durante 3 minutos. Después de la polimerización en cadena, agregue el material amplificado directamente a la mezcla de enzima quinasa-ligasa-DpnI del kit por 1 h a temperatura ambiente para la eliminación de la circularización y plantilla. Nota: La mezcla de reacción contiene 1 μl del producto PCR, 5 μl de 2 X Buffer de reacción, 1 μl de mezcla de enzima quinasa-ligasa-DpnI de X 10 y 3 μl de agua libre de nucleasa.</li>
	</ol>
</li>
	<li>Añadir 5 μl de la mezcla de reacción con el tubo 25 μl descongelado competentes de e. coli DH5α células del kit. Cuidadosamente el tubo para mezclar la película y coloque la mezcla en hielo durante 30 min choque del calor la mezcla a 42 ° C por 30 s y el lugar en hielo durante 5 minutos adicionales.<ol>
<li>Pipetear 600 μl de caldo Super óptima con los medios de represión (SOC) de catabolito del kit de temperatura en la mezcla, incubar a 37 ° C durante 60 min, con agitación a 250 rpm, 100 μL en una placa de agar de lisogenia caldo (LB) con el correspondiente antibiótico de propagación e incubar toda la noche a 37 ° C con agitación a 250 rpm.</li>
	</ol>
</li>
	<li>Seleccionar colonias solo 4-6 en 6 mL fresco LB medios con el antibiótico correspondiente e incubar durante una noche a 37 ° C con agitación a 250 rpm. Extraer plásmidos de cada cultura durante la noche por el kit de purificación del plásmido, siguiendo el manual del fabricante, luego enviar plásmidos para la secuenciación del ADN según el protocolo de la empresa para confirmar la mutación del codón de parada en posición correcta.</li>
	<li>Almacenar la tensión con la secuencia correcta a-80 ° C mediante la mezcla de cultura durante la noche de 1 mL y 300 μL 100% DMSO.</li>
</ol>2. expresión de la proteína acetilada
<ol><li>Introducir los genes de optimizado acetyllysyl-tRNA sintetasa33 y optimizado tRNAPyl 32 en el plásmido de pTech . Lugar gen tRNA sintetasa bajo el promotor constitutivo lpp . Lugar el gen tRNA bajo el promotor constitutivo proK del34.<ol>
<li>Transformar conjuntamente la expresión vector34 que contiene el gene transformado que contiene la etiqueta de la malato deshidrogenasa, y el plásmido que el sistema de incorporación de acetyllysine optimizado, en 25 μl descongeladas competente e. coli BL21(DE3) células por choque térmico a 42 ° C por 10 s y el lugar en el hielo durante 5 minutos adicionales.</li>
		<li>Pipetear 600 μl de medio SOC de temperatura en la mezcla, incubar a 37 ° C durante 60 min con agitación en rpm 275, extensión 100 μL en una placa con estreptomicina μg/mL 100 y 50 μg/mL cloranfenicol e incubar durante una noche a 37 ° C con agitación a 275 rpm.</li>
	</ol>
</li>
	<li>Recoger una sola Colonia de la placa e inocular en medios LB frescos 15 mL con 100 estreptomicina μg/mL y el cloramfenicol 50 μg/mL en un tubo de 50 mL durante la noche a 37 ° C con agitación a la velocidad de 250 rpm. Transferencia de la cultura durante la noche de 15 mL a 300 mL fresco LB medios con antibióticos en un matraz de 1 L e incubar a 37 ° C con agitación a 250 rpm.</li>
	<li>Disolver acetyllysine con agua para hacer la solución stock de 100 mM, almacenar a 4 ° C. Añadir acetyllysine de 5 mM y 20 mM nicotinamida (inhibidor de desacetilasas) a los medios de crecimiento cuando la absorbancia alcanza 0.5 a 600 nm.<ol>
<li>Cultivar células por un adicional 1 h a 37 ° C, agitación a 250 rpm, añada 0,5 mM IPTG para expresión de la proteína y crecen las células a 25 ° C durante la noche, con agitación a 180 rpm. Nota: Las condiciones de expresión necesario optimización para diferentes proteínas.</li>
	</ol>
</li>
	<li>Recogen las células por centrifugación a 3.000 x g a 4 ° C durante 15 minutos, descartar el sobrenadante y lavar el pellet celular con el tampón fosfato salino (PBS) buffer (10 mM de Na2HPO4, 1,8 mM KH2PO4, 137 mM NaCl, 2,7 mM KCl). Recoger las células lavadas a 10.000 x g a 4 ° C por 5 min, descartar el sobrenadante y almacenar pellets de células a-80 ° C.</li>
</ol>3. purificación de la proteína acetilada
<ol><li>Descongelar los pellets de células congeladas en el hielo y vuelva a suspender con 15 mL de tampón de lisis (50 mM tris (hidroximetil) aminometano (Tris), pH 7.8, 300 mM de NaCl, imidazol de 20 mM y 20 mM nicotinamida), 5 μl de β-mercaptoetanol y nucleasa de Benzonase μL 1 (250 unidades).</li>
	<li>Rompen las células por sonicación de 40 kHz a 70% potencia de salida con 10 ciclos de ráfagas cortas de 10 s, seguidos por intervalos de 30 s para la refrigeración de extracto crudo de la forma. Extracto de centrífuga crudo a 20.000 x g durante 25 minutos a 4 ° C. Filtrar el sobrenadante con el filtro de membrana de 0,45 μm y cargar en una columna que contiene 1 mL de resina (Ni-NTA) ácido nitrilotriacético níquel, equilibrada con 20 mL de agua y 20 mL de tampón de lisis. Nota: Las células también podrían romper por detergentes suaves, si no hay baño de ultrasonidos.</li>
	<li>Lavar la columna con 20 mL de tampón de lavado (50 mM Tris, pH 7.8, 300 mM de NaCl, imidazol de 50 mM y 20 mM nicotinamida) y luego eluir con 2 mL de tampón de elución (50 mM Tris, pH 7.8, 300 mM de NaCl, imidazol de 150 mM y 20 mM nicotinamida).</li>
	<li>Desalar la fracción de elución con buffer 25 mM Tris pH 7,8 y 10 mM (NaCl) la desalación la columna PD-10, siguiendo el manual del fabricante. Medir la concentración de la proteína eluída siguiendo la instrucción del reactivo de análisis de la proteína de Bradford. La proteína desalada está lista para más experimentos. Nota: Hacer stock de glicerol 50% de la proteína y guardar en-80 ° C para el almacenamiento.</li>
</ol>4. bioquímico caracterización de la proteína acetilada
<ol><li>
Análisis de SDS-PAGE y masa espectrometría.
	<ol>
<li>Desnaturalizar las proteínas con el sodio dodecil sulfato (SDS) tampón de muestra (5 μl proteína muestra con 2 μl 4 X tampón SDS) en un tubo de 2 mL a 105 ° C por 5 min, centrifugar la mezcla a 2000 x g durante 10 s, carga sobre el 4-20% sodio dodecil sulfato poliacrilamida gel este gel oresis (SDS-PAGE) y ejecutar a 200 V durante 30 minutos.</li>
		<li>Lavar el gel con agua destilada y agitar suavemente durante 5 min, repetir el proceso 3 veces. Deseche el agua y teñir el gel con colorante azul de Coomassie para 1 h con agitación suave. -Teñir el gel con agua destilada, agitar suavemente durante 30 minutos y repita esto de manchas 3 veces.</li>
		<li>Corte la banda de 33 kDa en el gel SDS-PAGE teñido de azul de Coomassie y envían a instalaciones de espectrometría de masas o las empresas para confirmar que la acetyllysine fue incorporada en la posición diseñada. Nota: El protocolo de análisis de espectrometría de masas siguió el experimento anterior34.</li>
	</ol>
</li>
	<li>
El borrar occidental
	<ol>
<li>Correr el gel SDS-PAGE con el mismo protocolo en el paso 4.1. Después el gel ejecutar, poner en remojo el gel con el tampón de transferencia (25 mM Tris, glicina 192 mM, pH 8.3 y 20% metanol) durante 15 minutos.</li>
		<li>Activar un 0.2 μm, membrana de difluoruro (PVDF) del polivinilideno de 7 cm x 8,5 cm con metanol durante 1 min y lavar con tampón de transferencia antes de preparar el sándwich de transferencia. Nota: El metanol es peligroso en caso de contacto con la piel, contacto con los ojos, ingestión o inhalación. La sobreexposición severa puede causar la muerte.</li>
		<li>Hacer el sandwich de la transferencia del cátodo al ánodo (esponja, papel de filtro, SDS-PAGE gel, PVDF membrana, papel de filtro y esponja). Poner la pila en el tanque de la transferencia, a una corriente constante de 350 mA para 45 minutos. Nota: Tiempo de transferencia puede necesitar optimización.</li>
		<li>Lavar la membrana PVDF con 25 mL con tampón Tris salino, 0,1% Tween 20 (TBST) (137 mM NaCl, 20 mM Tris, 0,1% Tween 20, pH 7,6) buffer por 5 min con agitación suave. Bloquear la membrana con 5% albúmina sérica bovina (BSA) en el buffer TBST por 1 h a temperatura ambiente.</li>
		<li>Incubar la membrana con acetyllysine-anticuerpo conjugado con HRP con una concentración final de 1 μg/mL diluido con 5% de BSA en TBST a 4 ° C durante la noche con agitación suave. Nota: Para resultados más rápidos, este paso podría realizarse a temperatura ambiente durante 1 hora. La dilución del anticuerpo puede necesitar optimización.</li>
		<li>Lavar la membrana con 20 mL de tampón de TBST por 5 min con agitación suave, repetir el paso 4 veces. El sustrato de la quimioluminescencia se aplica a la membrana siguiendo las instrucciones del fabricante. Capturar la señal con un sensor de cámara de dispositivo de carga acoplada (CCD).</li>
	</ol>
</li>
</ol>

<ol>
	<li>Krishna, R. G., Wold, F. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Post-translational+modification+of+proteins.">Post-translational modification of proteins.</a> Adv Enzymol Relat Areas Mol Biol. 67, 265-298 (1993).</li><li>Lothrop, A. P., Torres, M. P., Fuchs, S. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Deciphering+post-translational+modification+codes.">Deciphering post-translational modification codes.</a> FEBS Lett. 587 (8), 1247-1257 (2013).</li><li>Walsh, C. T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=.">.</a> Posttranslational modification of proteins : expanding nature's inventory. , (2006).</li><li>Khoury, G. A., Baliban, R. C., Floudas, C. A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Proteome-wide+post-translational+modification+statistics:+frequency+analysis+and+curation+of+the+swiss-prot+database.">Proteome-wide post-translational modification statistics: frequency analysis and curation of the swiss-prot database.</a> Sci Rep. 1, (2011).</li><li>Grotenbreg, G., Ploegh, H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Chemical+biology:+dressed-up+proteins.">Chemical biology: dressed-up proteins.</a> Nature. 446 (7139), 993-995 (2007).</li><li>Arif, M., Selvi, B. R., Kundu, T. K. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Lysine+acetylation:+the+tale+of+a+modification+from+transcription+regulation+to+metabolism.">Lysine acetylation: the tale of a modification from transcription regulation to metabolism.</a> Chembiochem. 11 (11), 1501-1504 (2010).</li><li>Cohen, T., Yao, T. P. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=AcK-knowledge+reversible+acetylation.">AcK-knowledge reversible acetylation.</a> Science's STKE : signal transduction knowledge environment. (245), pe42 (2004).</li><li>Drazic, A., Myklebust, L. M., Ree, R., Arnesen, T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+world+of+protein+acetylation.">The world of protein acetylation.</a> Biochim Biophys Acta. 1864 (10), 1372-1401 (2016).</li><li>Escalante-Semerena, J. C. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=N&#949;-acetylation+control+conserved+in+all+three+life+domains.">N&#949;-acetylation control conserved in all three life domains.</a> Microbe. 5, 340-344 (2010).</li><li>Kouzarides, T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Acetylation:+a+regulatory+modification+to+rival+phosphorylation?.">Acetylation: a regulatory modification to rival phosphorylation?.</a> The EMBO journal. 19 (6), 1176-1179 (2000).</li><li>Soppa, J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protein+acetylation+in+archaea,+bacteria,+and+eukaryotes.">Protein acetylation in archaea, bacteria, and eukaryotes.</a> Archaea. , (2010).</li><li>Verdin, E., Ott, M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=50+years+of+protein+acetylation:+from+gene+regulation+to+epigenetics,+metabolism+and+beyond.">50 years of protein acetylation: from gene regulation to epigenetics, metabolism and beyond.</a> Nat Rev Mol Cell Biol. 16 (4), 258-264 (2015).</li><li>Allfrey, V. G., Faulkner, R., Mirsky, A. E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Acetylation+and+Methylation+of+Histones+and+Their+Possible+Role+in+the+Regulation+of+Rna+Synthesis.">Acetylation and Methylation of Histones and Their Possible Role in the Regulation of Rna Synthesis.</a> P Natl Acad Sci USA. 51, 786-794 (1964).</li><li>Phillips, D. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+presence+of+acetyl+groups+of+histones.">The presence of acetyl groups of histones.</a> Biochem j. 87, 258-263 (1963).</li><li>Sterner, D. E., Berger, S. L. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Acetylation+of+histones+and+transcription-related+factors.">Acetylation of histones and transcription-related factors.</a> Microbiology and molecular biology reviews: MMBR. 64 (2), 435-459 (2000).</li><li>Glozak, M. A., Sengupta, N., Zhang, X., Seto, E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Acetylation+and+deacetylation+of+non-histone+proteins.">Acetylation and deacetylation of non-histone proteins.</a> Gene. 363, 15-23 (2005).</li><li>Close, P., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+emerging+role+of+lysine+acetylation+of+non-nuclear+proteins.">The emerging role of lysine acetylation of non-nuclear proteins.</a> Cell Mol Life Sci. 67 (8), 1255-1264 (2010).</li><li>Iyer, A., Fairlie, D. P., Brown, L. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Lysine+acetylation+in+obesity,+diabetes+and+metabolic+disease.">Lysine acetylation in obesity, diabetes and metabolic disease.</a> Immunol Cell Biol. 90 (1), 39-46 (2012).</li><li>You, L., Nie, J., Sun, W. J., Zheng, Z. Q., Yang, X. J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Lysine+acetylation:+enzymes,+bromodomains+and+links+to+different+diseases.">Lysine acetylation: enzymes, bromodomains and links to different diseases.</a> Essays Biochem. 52, 1-12 (2012).</li><li>Bonnaud, E. M., Suberbielle, E., Malnou, C. E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Histone+acetylation+in+neuronal+(dys)function.">Histone acetylation in neuronal (dys)function.</a> Biomol Concepts. 7 (2), 103-116 (2016).</li><li>Fukushima, A., Lopaschuk, G. D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Acetylation+control+of+cardiac+fatty+acid+beta-oxidation+and+energy+metabolism+in+obesity,+diabetes,+and+heart+failure.">Acetylation control of cardiac fatty acid beta-oxidation and energy metabolism in obesity, diabetes, and heart failure.</a> Biochim Biophys Acta. 1862 (12), 2211-2220 (2016).</li><li>Kaypee, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Aberrant+lysine+acetylation+in+tumorigenesis:+Implications+in+the+development+of+therapeutics.">Aberrant lysine acetylation in tumorigenesis: Implications in the development of therapeutics.</a> Pharmacol Ther. 162, 98-119 (2016).</li><li>Tapias, A., Wang, Z. Q. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Lysine+Acetylation+and+Deacetylation+in+Brain+Development+and+Neuropathies.">Lysine Acetylation and Deacetylation in Brain Development and Neuropathies.</a> Genomics Proteomics Bioinformatics. 15 (1), 19-36 (2017).</li><li>Hu, L. I., Lima, B. P., Wolfe, A. J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Bacterial+protein+acetylation:+the+dawning+of+a+new+age.">Bacterial protein acetylation: the dawning of a new age.</a> Molecular microbiology. 77 (1), 15-21 (2010).</li><li>Jones, J. D., O'Connor, C. D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protein+acetylation+in+prokaryotes.">Protein acetylation in prokaryotes.</a> Proteomics. 11 (15), 3012-3022 (2011).</li><li>Bernal, V., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Regulation+of+bacterial+physiology+by+lysine+acetylation+of+proteins.">Regulation of bacterial physiology by lysine acetylation of proteins.</a> New biotechnol. 31 (6), 586-595 (2014).</li><li>Hentchel, K. L., Escalante-Semerena, J. C. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Acylation+of+Biomolecules+in+Prokaryotes:+a+Widespread+Strategy+for+the+Control+of+Biological+Function+and+Metabolic+Stress.">Acylation of Biomolecules in Prokaryotes: a Widespread Strategy for the Control of Biological Function and Metabolic Stress.</a> Microbiology and molecular biology reviews : MMBR. 79 (3), 321-346 (2015).</li><li>Ouidir, T., Kentache, T., Hardouin, J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protein+lysine+acetylation+in+bacteria:+Current+state+of+the+art.">Protein lysine acetylation in bacteria: Current state of the art.</a> Proteomics. 16 (2), 301-309 (2016).</li><li>Wolfe, A. J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Bacterial+protein+acetylation:+new+discoveries+unanswered+questions.">Bacterial protein acetylation: new discoveries unanswered questions.</a> Curr Genet. 62 (2), 335-341 (2016).</li><li>Albaugh, B. N., Arnold, K. M., Lee, S., Denu, J. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Autoacetylation+of+the+histone+acetyltransferase+Rtt109.">Autoacetylation of the histone acetyltransferase Rtt109.</a> J Biol Chem. 286 (28), 24694-24701 (2011).</li><li>Neumann, H., Peak-Chew, S. Y., Chin, J. W. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Genetically+encoding+N&#949;-acetyllysine+in+recombinant+proteins.">Genetically encoding N&#949;-acetyllysine in recombinant proteins.</a> Nat chem biol. 4 (4), 232-234 (2008).</li><li>Fan, C., Xiong, H., Reynolds, N. M., Soll, D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Rationally+evolving+tRNAPyl+for+efficient+incorporation+of+noncanonical+amino+acids.">Rationally evolving tRNAPyl for efficient incorporation of noncanonical amino acids.</a> Nucleic Acids Res. 43 (22), e156 (2015).</li><li>Bryson, D., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Continuous+directed+evolution+of+aminoacyl-tRNA+synthetases+to+alter+amino+acid+specificity+and+enhance+activity.">Continuous directed evolution of aminoacyl-tRNA synthetases to alter amino acid specificity and enhance activity.</a> Nat Chem Biol. , (2017).</li><li>Venkat, S., Gregory, C., Sturges, J., Gan, Q., Fan, C. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Studying+the+Lysine+Acetylation+of+Malate+Dehydrogenase.">Studying the Lysine Acetylation of Malate Dehydrogenase.</a> J Mol Biol. 429 (9), 1396-1405 (2017).</li><li>Venkat, S., Gregory, C., Gan, Q., Fan, C. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Biochemical+characterization+of+the+lysine+acetylation+of+tyrosyl-tRNA+synthetase+in+Escherichia+coli.">Biochemical characterization of the lysine acetylation of tyrosyl-tRNA synthetase in Escherichia coli.</a> Chembiochem. 18 (19), 1928-1934 (2017).</li><li>Liu, C. C., Schultz, P. G. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Adding+new+chemistries+to+the+genetic+code.">Adding new chemistries to the genetic code.</a> Annu Rev Biochem. 79, 413-444 (2010).</li><li>Mukai, T., Lajoie, M. J., Englert, M., Soll, D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Rewriting+the+Genetic+Code.">Rewriting the Genetic Code.</a> Annu Rev Microbiol. , (2017).</li><li>O'Donoghue, P., Ling, J., Wang, Y. S., Soll, D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Upgrading+protein+synthesis+for+synthetic+biology.">Upgrading protein synthesis for synthetic biology.</a> Nat Chem Biol. 9 (10), 594-598 (2013).</li><li>Chin, J. W. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Expanding+and+reprogramming+the+genetic+code+of+cells+and+animals.">Expanding and reprogramming the genetic code of cells and animals.</a> Annu Rev Biochem. 83, 379-408 (2014).</li><li>O'Donoghue, P., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Near-cognate+suppression+of+amber,+opal+and+quadruplet+codons+competes+with+aminoacyl-tRNAPyl+for+genetic+code+expansion.">Near-cognate suppression of amber, opal and quadruplet codons competes with aminoacyl-tRNAPyl for genetic code expansion.</a> FEBS Lett. 586 (21), 3931-3937 (2012).</li><li>Aerni, H. R., Shifman, M. A., Rogulina, S., O'Donoghue, P., Rinehart, J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Revealing+the+amino+acid+composition+of+proteins+within+an+expanded+genetic+code.">Revealing the amino acid composition of proteins within an expanded genetic code.</a> Nucleic Acids Res. 43 (2), e8 (2015).</li><li>Huang, Y., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+convenient+method+for+genetic+incorporation+of+multiple+noncanonical+amino+acids+into+one+protein+in+Escherichia+coli.">A convenient method for genetic incorporation of multiple noncanonical amino acids into one protein in Escherichia coli.</a> Mol Biosyst. 6 (4), 683-686 (2010).</li><li>Venkat, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Genetically+encoding+thioacetyl-lysine+as+a+nondeacetylatable+analog+of+lysine+acetylation+in+Escherichia+coli.">Genetically encoding thioacetyl-lysine as a nondeacetylatable analog of lysine acetylation in Escherichia coli.</a> FEBS Open. , (2017).</li><li>Wan, W., Tharp, J. M., Liu, W. R. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Pyrrolysyl-tRNA+synthetase:+an+ordinary+enzyme+but+an+outstanding+genetic+code+expansion+tool.">Pyrrolysyl-tRNA synthetase: an ordinary enzyme but an outstanding genetic code expansion tool.</a> Biochim Biophys Acta. 1844 (6), 1059-1070 (2014).</li><li>Gregoretti, I. V., Lee, Y. M., Goodson, H. V. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Molecular+evolution+of+the+histone+deacetylase+family:+functional+implications+of+phylogenetic+analysis.">Molecular evolution of the histone deacetylase family: functional implications of phylogenetic analysis.</a> J Mol Biol. 338 (1), 17-31 (2004).</li><li>Weinert, B. T., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Acetyl-phosphate+is+a+critical+determinant+of+lysine+acetylation+in+E.+coli.">Acetyl-phosphate is a critical determinant of lysine acetylation in E. coli.</a> Mol cell. 51 (2), 265-272 (2013).</li></ol>

Los autores no tienen nada que revelar.

La incorporación genética de noncanonical aminoácidos (ncAAs) se basa en la supresión de un codón asignado, sobre todo el ámbar stop codón UAG36,37,38,39, por el tRNA cargado de ncAA que contiene el anticodon correspondiente. Como es sabido, el codón UAG es reconocido por el factor de liberación-1 (RF1) en bacterias y puede también ser suprimido por cerca de tRNAs cognado de anfitriones por aminoácidos canónicos (cAAs) como lisina y tirosina40,41. Por lo tanto, la eficacia de la incorporación de la ncAA en el codón UAG depende de la competencia entre ncAA-tRNAs y RF1, mientras que la pureza de la incorporación de la ncAA se basa en la competencia entre los tRNAs cargados de ncAA y cAA-cargado cerca de tRNAs cognado. Bajo rendimiento y la pureza de la proteína diana acetilado pueden ser causadas por la eficacia de incorporación bajo del par orthogonal introducido en las células hospedadoras. Este problema podría solucionarse aumentando la concentración de acetyllysine en los medios de comunicación y utilizando recientemente optimizado sistemas de incorporación de acetyllysine, que aumentaron la represión de codón UAG veces 5832,33, ambos se mejorará la eficiencia y la pureza de la incorporación de acetyllysine. Como se muestra en la figura 1 y la comparación de rendimientos de proteína, la eficacia de la incorporación de acetyllysine era alrededor del 50% y no había detectable proteína purificada a partir de las células que el sistema de incorporación de AcK y el gen mutado de MDH, pero sin confirmación de medios de cultivo, que indicaron la pureza de la incorporación de acetyllysine. Por otra parte, análisis de espectrometría de masas también no mostró ningún cAAs en la posición 140 de MDH, que indica la homogeneidad de la incorporación de acetyllysine.
Hay dos principales limitaciones de este enfoque. En primer lugar, debido a la competencia de acetyllysine-charged tRNA con ambos RF1 y cAA-cargado cerca de tRNAs cognado descrito anteriormente, en la actualidad, el número máximo de acetyllysine los residuos que pueden ser incorporados simultáneamente en una única proteína es tres 33,42. En segundo lugar, las células tienen otros tipos de desacetilasas, que resisten la nicotinamida y pueden deacetylate ciertas proteínas objetivo. Por lo tanto, las proteínas no pueden alcanzar 100% acetilación en sitios específicos. Recientemente, hemos establecido un sistema de incorporación de tio-acetyllysine que puede ser utilizado como un análogo no deacetylable de la acetyllysine43, así este sistema podría ser una buena alternativa en este caso.
Como se mencionó anteriormente, el enfoque clásico para caracterizar bioquímicamente la acetilación de la lisina está utilizando mutagénesis sitio-dirigida. Glutamina es utilizada como un imitador de acetyllysine y arginina es utilizada como un imitador de lisina no acetilada. Sin embargo, ambos imitadores no isosteres real y no siempre producen los resultados esperados30. La estrategia de expansión del código genético podría generar homogéneo acetiladas proteínas en residuos de lisina específico, cual es la manera más rigurosa para caracterizar las proteínas acetiladas.
El sistema de incorporación genética para acetyllysine fue derivado del par de pyrrolysyl-tRNA sintetasa variantes y su cognado tRNA de especies Methanosarcinaceae , que también es conocidas por ser ortogonales en eucariotas44. Estudios previos han demostrado que este sistema puede aplicarse en células de mamíferos y ciertos animales por acetilación de proteínas estudios39, por lo tanto el presente Protocolo se podría ampliar a células de mamíferos y animales incluso para usos más amplios en médico investigación y la industria. Además, este protocolo es esencialmente el mismo protocolo utilizado para incorporar diferentes tipos de ncAAs, haciendo necesario un cambio sencillo al par orthogonal introducido en las células hospedadoras.
Lisina deacetilasas (KDACs) quitar el grupo acetilo de los residuos de lisina acetilada en proteínas45. Sirtuina-tipo CobB es la deacetilasa sólo conocido en e. coli, que puede ser inhibida por nicotinamida27. Por lo tanto, para evitar la deacetylation acetilado proteína generada durante el crecimiento celular y purificación de proteínas, nicotinamida 20 a 50 mM debe agregarse en medios de cultivo y purificación búferes. Una vez purificado, la acetilación de residuos de lisina es relativamente estable debido a la falta de deacetilasa. En segundo lugar, para bajar el fondo de la acetilación no específico en otros residuos de lisina en la proteína, la BL21 (DE3) cepa fue utilizado como la cepa de expresión, debido a su menor nivel de acetilación de proteínas que comúnmente usadas derivados de K12 cepas46 . Como se muestra en la figura 2, el MDH de tipo salvaje de BL21(DE3) células no tenía detectable acetilación por borrar occidental. Este es otro factor importante para aumentar la pureza de la acetilación en la proteína diana.

(PTMs) las modificaciones post-traduccionales de las proteínas ocurren después del proceso de traducción y surgen de adición covalente de grupos funcionales a los residuos del aminoácido, jugando papeles importantes en casi todos los procesos biológicos, incluyendo gene transcripción, respuesta al estrés, diferenciación celular y metabolismo1,2,3. Hasta la fecha, cerca de 400 distintivo PTMs han sido identificados4. La complejidad del genoma y el proteoma se amplifica en gran medida por la proteína MPa, regular localización y actividad de la proteína, y afectan la interacción con otras moléculas como proteínas, ácidos nucleicos, lípidos y cofactores5.
Acetilación de proteínas ha estado a la vanguardia de los estudios de MPa en las última dos décadas6,7,8,9,10,11,12. Acetilación de la lisina fue descubierta en las histonas hace más de 50 años13,14, ha sido bien analizado y se sabe para existir en más de 80 factores de transcripción, reguladores y varias proteínas15, 16,17. Estudios sobre la acetilación de proteínas no sólo nos proporciona una comprensión más profunda de sus mecanismos reguladores, sino también guiada por tratamientos para un número de enfermedades causadas por acetilación disfuncional18,19, 20 , 21 , 22 , 23. se creía que la acetilación de la lisina ocurre solo en eucariotas, pero estudios recientes han demostrado que la acetilación de proteínas también juega un papel clave en la fisiología bacteriana, incluyendo chemotaxis, resistencia ácida, la activación y estabilización de Islas de patogenicidad y virulencia otra relacionadas con las proteínas24,25,26,27,28,29.
Un método comúnmente utilizado para caracterizar bioquímicamente la acetilación de la lisina está utilizando mutagénesis sitio-dirigida. Glutamina es utilizada como un imitador de acetyllysine debido a su tamaño y polaridad similar. Arginina es utilizada como un imitador de lisina no acetilado, ya que conserva su carga positiva en condiciones fisiológicas pero no puede ser acetilado. Sin embargo, ambos imitadores no son isosteres reales y no siempre producen los resultados esperados30. El enfoque más riguroso es generar homogéneo acetiladas proteínas en residuos de lisina específico, que es difícil o imposible por métodos más clásicos debido a la baja estequiometría de acetilación de la lisina en naturaleza7,11. Este desafío ha sido desentrañando la estrategia de expansión del código genético, que emplea una ingeniería pyrrolysyl-tRNA sintetasa variante de especies Methanosarcinaceae para cargar tRNAPyl con acetyllysine, utiliza el host traslacional maquinaria para suprimir la UAG stop codon en el mRNA y dirige la incorporación de acetyllysine en la posición diseñada de la proteína blanco del31. Recientemente, hemos optimizado este sistema con una mejor EF-Tu-Unión tRNA32 y un actualizado acetyllysyl-tRNA sintetasa33. Además, hemos aplicado este sistema mayor incorporación en estudios de acetilación de la malato deshidrogenasa34 y Tirosil tRNA sintetasa35. Aquí, demostramos el protocolo para la generación de proteínas puramente acetiladas de la clonación molecular para identificación bioquímica mediante el uso de malato deshidrogenasa (MDH), que hemos estudiado como ejemplo demostrativo.

<table border="0" cellpadding="0" cellspacing="0" width="615">
	<tbody>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">Bradford protein assay</td>
			<td style="width:113px;">Bio-Rad</td>
			<td style="width:119px;">5000006</td>
			<td style="width:167px;">Protein concentration</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">4x Laemmli Sample Buffer</td>
			<td style="width:113px;">Bio-Rad</td>
			<td style="width:119px;">1610747</td>
			<td style="width:167px;">SDS sample buffer</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">Coomassie G-250 Stain</td>
			<td style="width:113px;">Bio-Rad</td>
			<td style="width:119px;">1610786</td>
			<td style="width:167px;">SDS-PAGE gel staining</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">4-20% SDS-PAGE ready gel</td>
			<td style="width:113px;">Bio-Rad</td>
			<td style="width:119px;">4561093</td>
			<td style="width:167px;">Protein determination</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">Ac-K-100 (HRP Conjugate)</td>
			<td style="width:113px;">Cell Signaling</td>
			<td style="width:119px;">6952</td>
			<td style="width:167px;">Antibody</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">IPTG</td>
			<td style="width:113px;">CHEM-IMPEX</td>
			<td style="width:119px;">194</td>
			<td style="width:167px;">Expression inducer</td>
		</tr>
		<tr height="23">
			<td height="23" style="height:23px;width:216px;">N&#949;-Acetyl-L-lysine</td>
			<td style="width:113px;">CHEM-IMPEX</td>
			<td style="width:119px;">5364</td>
			<td style="width:167px;">Noncanonical amino acid</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">PD-10 desalting column</td>
			<td style="width:113px;">GE Healthcare</td>
			<td style="width:119px;">17085101</td>
			<td style="width:167px;">Desalting</td>
		</tr>
		<tr height="40">
			<td height="40" style="height:40px;width:216px;">Q5 Site-Directed Mutagenesis Kit</td>
			<td style="width:113px;">NEB</td>
			<td style="width:119px;">E0554</td>
			<td style="width:167px;">Introducing the stop codon</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">BL21 (DE3) cells</td>
			<td style="width:113px;">NEB</td>
			<td style="width:119px;">C2527</td>
			<td style="width:167px;">Expressing strain</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">QIAprep Spin Miniprep Kit</td>
			<td style="width:113px;">QIAGEN</td>
			<td style="width:119px;">27106</td>
			<td style="width:167px;">Extracting plasmids</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">Ni-NTA resin</td>
			<td style="width:113px;">QIAGEN</td>
			<td style="width:119px;">30210</td>
			<td style="width:167px;">Affinity purification resin</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">nicotinamide</td>
			<td style="width:113px;">Sigma-Aldrich</td>
			<td style="width:119px;">N3376</td>
			<td style="width:167px;">Deacetylase inhibitor</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">&#946;-Mercaptoethanol</td>
			<td style="width:113px;">Sigma-Aldrich</td>
			<td style="width:119px;">M6250</td>
			<td style="width:167px;">Reducing agent</td>
		</tr>
		<tr height="40">
			<td height="40" style="height:40px;width:216px;">BugBuster Protein Extraction Reagent</td>
			<td style="width:113px;">Sigma-Aldrich</td>
			<td style="width:119px;">70584</td>
			<td style="width:167px;">Breaking cells</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">Benzonase nuclease</td>
			<td style="width:113px;">Sigma-Aldrich</td>
			<td style="width:119px;">E1014</td>
			<td style="width:167px;">DNase</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">ECL Western Blotting Substrate</td>
			<td style="width:113px;">ThermoFisher</td>
			<td style="width:119px;">32106</td>
			<td style="width:167px;">Chemiluminescence</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">Premixed LB Broth</td>
			<td style="width:113px;">VWR</td>
			<td style="width:119px;">97064</td>
			<td style="width:167px;">Cell growth medium</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">Bovine serum albumin</td>
			<td style="width:113px;">VWR</td>
			<td style="width:119px;">97061-416</td>
			<td style="width:167px;">western blots blocking</td>
		</tr>
	</tbody>
</table>

a facile protocol to generate site-specifically acetylated proteins in escherichia coli

Modificaciones post-traduccionales que ocurren en las posiciones específicas de proteínas han demostrado desempeñar un papel importante en una variedad de procesos celulares. Entre ellos, la acetilación reversible de la lisina es uno de los más ampliamente distribuidos en todos los ámbitos de la vida. Aunque se han realizado numerosos estudios de acetylome basada en espectrometría de masa, más caracterización de estos objetivos de acetilación putativo ha sido limitada. Una razón posible es que es difícil generar proteínas puramente acetiladas en posiciones deseadas por mayoría enfoques bioquímicos clásicos. Para superar este reto, se ha aplicado la técnica de expansión del código genético para utilizar el par de una variante de ingeniería pyrrolysyl-tRNA sintetasa y su cognado tRNA de las especies de Methanosarcinaceae , para dirigir la incorporación cotranslacional de acetyllysine en el sitio específico en la proteína de interés. Después de la primera aplicación en el estudio de la acetilación de histonas, este enfoque ha facilitado estudios de acetilación sobre una variedad de proteínas. En este trabajo, hemos demostrado un protocolo fácil para producir proteínas site-specifically acetiladas utilizando la bacteria Escherichia coli de la modelo como anfitrión. Malato deshidrogenasa fue utilizada como un ejemplo de demostración en este trabajo.

El rendimiento de proteína MDH acetilado fue 15 mg por cultura de 1 L, mientras que la de tipo salvaje MDH fue 31 mg por cultura de 1 L. Proteínas purificadas fueron analizadas por SDS-PAGE, como se muestra en la figura 1. El MDH de tipo salvaje fue utilizado como un control positivo de34. La proteína purificada de células que el sistema de incorporación de acetyllysine (AcK) y el gen mutante mdh , pero sin confirmación en medios de crecimiento, se utilizó como control negativo. Acetilación de la lisina de las proteínas purificadas fue detectada por western blot utilizando el anticuerpo acetyllysine como se muestra en la figura 2. La acetilación de los residuos de lisina 140 en malato deshidrogenasa fue confirmada por análisis de espectrometría de masas tándem como se muestra en la figura 3.
La secuencia de la proteína de la proteína MDH (el fragmento para análisis de MS tandem está en negrita):
MKVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSGEDAT PALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAA EVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQVPGV SFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVVECAY VEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAFEQNALEGMLDTLKKDIALGEEFVNK
La secuencia de la proteína de acetyllysyl optimizado-tRNA sintetasa33:
MDKKPLDVLISATGLWMSRTGTLHKIKHYEISRSKIYIEMACGDHLVVNNSRSCRPARAFRYHKY RKTCKRCRVSDEDINNFLTRSTEGKTSVKVKVVSEPKVKKAMPKSVSRAPKPLENPVSAKAST DTSRSVPSPAKSTPNSPVPTSASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRR KKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKN FCLRPMMAPNLLNYARKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCTRE NLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGF GLERLLKVKHDFKNIKRAARSESYYNGISTNL
La secuencia del gene del tRNA optimizadoPyl 32:
GGAAACGTGATCATGTAGATCGAATGGACTCTAAATCCGTTCAGTGGGGTTAGATTCCCC ACGTTTCCGCCA
<img alt="Figure 1" class="xfigimg" src="/files/ftp_upload/57061/57061fig1.jpg"> Figura 1 : El Coomassie teñido de azul gel de SDS-PAGE de MDH purificada de larga duración y su variante que contiene AcK. Los mismos volúmenes de elución fracciones fueron cargadas en el SDS-PAGE gel. <a href="//cloudflare-jove-com.remotexs.ntu.edu.sg/files/ftp_upload/57061/57061fig1large.jpg" target="_blank">Haga clic aquí para ver una versión más grande de esta figura.</a>
<img alt="Figure 2" class="xfigimg" src="/files/ftp_upload/57061/57061fig2.jpg"> Figura 2 : El borrar occidental de purificada MDH de tipo salvaje y su variante que contiene AcK. Los mismos volúmenes de fracciones elución fueron cargados. <a href="//cloudflare-jove-com.remotexs.ntu.edu.sg/files/ftp_upload/57061/57061fig2large.jpg" target="_blank">Haga clic aquí para ver una versión más grande de esta figura.</a>
<img alt="Figure 3" class="xfigimg" src="/files/ftp_upload/57061/57061fig3.jpg"> Figura 3 : LC-MS/MS análisis de variante de AcK que contiene MDH. El tándem espectro de masas de los péptidos (residuos 135-142) AGVYDKACNK de purificada acetilado variante MDH. KAC denota incorporación de AcK. La secuencia parcial del péptido que contiene el AcK se puede leer de la anotada b o serie de ion y. Emparejado picos estaban en rojo. <a href="//cloudflare-jove-com.remotexs.ntu.edu.sg/files/ftp_upload/57061/57061fig3large.jpg" target="_blank">Haga clic aquí para ver una versión más grande de esta figura.</a>

Watch this Scientific Journal Video about A Facile Protocol to Generate Site-Specifically Acetylated Proteins in Escherichia Coli at JoVE.com

A Facile Protocol to Generate Site-Specifically Acetylated Proteins in Escherichia Coli

Expansión del código genético sirve como una poderosa herramienta para el estudio de una amplia gama de procesos biológicos, incluyendo acetilación de proteínas. Aquí demostramos un protocolo fácil aprovechar esta técnica para generar homogéneo acetilado proteínas en sitios específicos en células de Escherichia coli .

Un protocolo fácil de generar proteínas Site-Specifically acetiladas en Escherichia Coli

Post-translational modifications that occur at specific positions of proteins have been shown to play important roles in a variety of cellular processes. ...

a-facile-protocol-to-generate-site-specifically-acetylated-proteins

Nanyang Technological University

Research

JoVE Journal

Immunology and Infection

A Facile Protocol to Generate Site-Specifically Acetylated Proteins in Escherichia Coli

6.8K vistas.  University of Arkansas. Expansión del código genético sirve como una poderosa herramienta para el estudio de una amplia gama de procesos biológicos, incluyendo acetilación de proteínas. Aquí demostramos un protocolo fácil aprovechar esta técnica para generar homogéneo acetilado proteínas en sitios específicos en células de Escherichia coli .

Video: A Facile Protocol to Generate Site-Specifically Acetylated Proteins in Escherichia Coli

Using Fluorescent Proteins to Visualize and Quantitate Chlamydia Vacuole Growth Dynamics in Living Cells

The obligate intracellular bacterium Chlamydia elicits a great burden on global public health. C.&#160;trachomatis is the leading bacterial cause of sexually transmitted infection and also the primary cause of preventable blindness in the world. An essential determinant for successful infection of host cells by Chlamydia is the bacterium's ability to manipulate host cell signaling from within a novel, vacuolar compartment called the inclusion. From within the inclusion, Chlamydia acquire nutrients required for their 2-3 day developmental growth, and they additionally secrete a panel of effector proteins onto the cytosolic face of the vacuole membrane and into the host cytosol. Gaps in our understanding of Chlamydia biology, however, present significant challenges for visualizing and analyzing this intracellular compartment. Recently, a reverse-imaging strategy for visualizing the inclusion using GFP expressing host cells was described. This approach rationally exploits the intrinsic impermeability of the inclusion membrane to large molecules such as GFP. In this work, we describe how GFP- or mCherry-expressing host cells are generated for subsequent visualization of chlamydial inclusions. Furthermore, this method is shown to effectively substitute for costly antibody-based enumeration methods, can be used in tandem with other fluorescent labels, such as GFP-expressing Chlamydia, and can be exploited to derive key quantitative data about inclusion membrane growth from a range of Chlamydia species and strains.

Using Fluorescent Proteins to Visualize and Quantitate Chlamydia Vacuole Growth Dynamics in Living Cells

A live cell fluorescent protein based method for illuminating cellular vacuoles (inclusions) containing Chlamydia is described. This strategy enables rapid, automated determination of Chlamydia infectivity in samples and can be used to quantitatively investigate inclusion growth dynamics.

El uso de proteínas fluorescentes para visualizar y cuantificar<em&gt; Chlamydia</em&gt; Vacuola dinámica de crecimiento en las células vivas

The obligate intracellular bacterium Chlamydia elicits a great burden on global public health. C.&#160;trachomatis is the leading bacterial cause of ...

Investigación

Inmunología e Infección

A Protocol to Infect Caenorhabditis elegans with Salmonella typhimurium

In the last decade, C. elegans has emerged as an invertebrate organism to study interactions between hosts and pathogens, including the host defense against gram-negative bacterium Salmonella typhimurium. Salmonella establishes persistent infection in the intestine of C. elegans and results in early death of infected animals. A number of immunity mechanisms have been identified in C. elegans to defend against Salmonella infections. Autophagy, an evolutionarily conserved lysosomal degradation pathway, has been shown to limit the Salmonella replication in C. elegans and in mammals. Here, a protocol is described to infect C. elegans with Salmonella typhimurium, in which the worms are exposed to Salmonella for a limited time, similar to Salmonella infection in humans. Salmonella infection significantly shortens the lifespan of C. elegans. Using the essential autophagy gene bec-1 as an example, we combined this infection method with C. elegans RNAi feeding approach and showed this protocol can be used to examine the function of C. elegans host genes in defense against Salmonella infection. Since C. elegans whole genome RNAi libraries are available, this protocol makes it possible to comprehensively screen for C. elegans genes that protect against Salmonella and other intestinal pathogens using genome-wide RNAi libraries.

A Protocol to Infect Caenorhabditis elegans with Salmonella typhimurium

C. elegans has emerged as a new genetic model to study host-pathogen interactions. Here we describe a protocol to infect C. elegans with Salmonella typhimurium coupled with the double-strand RNAi interference technique to examine the role of host genes in defense against Salmonella infection.

Un protocolo para infectar<em&gt; Caenorhabditis elegans</em&gt; Con<em&gt; Salmonella typhimurium</em

In the last decade, C. elegans has emerged as an invertebrate organism to study interactions between hosts and pathogens, including the host defense ...

Non-Invasive Model of Neuropathogenic Escherichia coli Infection in the Neonatal Rat

Investigation of the interactions between animal host and bacterial pathogen is only meaningful if the infection model employed replicates the principal features of the natural infection. This protocol describes procedures for the establishment and evaluation of systemic infection due to neuropathogenic Escherichia coli K1 in the neonatal rat. Colonization of the gastrointestinal tract leads to dissemination of the pathogen along the gut-lymph-blood-brain course of infection and the model displays strong age dependency. A strain of E. coli O18:K1 with enhanced virulence for the neonatal rat produces exceptionally high rates of colonization, translocation to the blood compartment and invasion of the meninges following transit through the choroid plexus. As in the human host, penetration of the central nervous system is accompanied by local inflammation and an invariably lethal outcome. The model is of proven utility for studies of the mechanism of pathogenesis, for evaluation of therapeutic interventions and for assessment of bacterial virulence.

Non-Invasive Model of Neuropathogenic Escherichia coli Infection in the Neonatal Rat

Here, a procedure is described for the establishment of systemic infection in the neonatal rat with cultures of Escherichia coli K1. This non-invasive procedure permits colonization of the gastrointestinal tract, translocation of the pathogen to the systemic circulation, and invasion of the central nervous system at the choroid plexus.

Modelo no invasiva de neuropatogénico<em&gt; Escherichia coli</em&gt; La infección en Neonatología Rata

Investigation of the interactions between animal host and bacterial pathogen is only meaningful if the infection model employed replicates the principal ...

Phage Phenomics: Physiological Approaches to Characterize Novel Viral Proteins

Current investigations into phage-host interactions are dependent on extrapolating knowledge from (meta)genomes. Interestingly, 60 - 95% of all phage sequences share no homology to current annotated proteins. As a result, a large proportion of phage genes are annotated as hypothetical. This reality heavily affects the annotation of both structural and auxiliary metabolic genes. Here we present phenomic methods designed to capture the physiological response(s) of a selected host during expression of one of these unknown phage genes. Multi-phenotype Assay Plates (MAPs) are used to monitor the diversity of host substrate utilization and subsequent biomass formation, while metabolomics provides bi-product analysis by monitoring metabolite abundance and diversity. Both tools are used simultaneously to provide a phenotypic profile associated with expression of a single putative phage open reading frame (ORF). Representative results for both methods are compared, highlighting the phenotypic profile differences of a host carrying either putative structural or metabolic phage genes. In addition, the visualization techniques and high throughput computational pipelines that facilitated experimental analysis are presented.

Here, we present phenomic approaches for the functional characterization of putative phage genes. Techniques include a developed assay capable of monitoring host anabolic metabolism, the Multi-phenotype Assay Plates (MAPs), in addition to the established method of metabolomics, capable of measuring effects to catabolic metabolism.

Fenómica fagos: enfoques fisiológicos para caracterizar Novela Virales Proteínas

Current investigations into phage-host interactions are dependent on extrapolating knowledge from (meta)genomes. Interestingly, 60 - 95% of all phage ...

One-step Negative Chromatographic Purification of Helicobacter pylori Neutrophil-activating Protein Overexpressed in Escherichia coli in Batch Mode

Helicobacter pylori neutrophil-activating protein (HP-NAP) is a major virulence factor of Helicobacter pylori (H. pylori). It plays a critical role in H. pylori-induced gastric inflammation by activating several innate leukocytes including neutrophils, monocytes, and mast cells. The immunogenic and immunomodulatory properties of HP-NAP make it a potential diagnostic and vaccine candidate for H. pylori and a new drug candidate for cancer therapy. In order to obtain substantial quantities of purified HP-NAP used for its clinical applications, an efficient method to purify this protein with high yield and purity needs to be established.
In this protocol, we have described a method for one-step negative chromatographic purification of recombinant HP-NAP overexpressed in Escherichia coli (E. coli) by using diethylaminoethyl (DEAE) ion-exchange resins (e.g., Sephadex) in batch mode. Recombinant HP-NAP constitutes nearly 70% of the total protein in E. coli and is almost fully recovered in the soluble fraction upon cell lysis at pH 9.0. Under the optimal condition at pH 8.0, the majority of HP-NAP is recovered in the unbound fraction while the endogenous proteins from E. coli are efficiently removed by the resin.
This purification method using negative mode batch chromatography with DEAE ion-exchange resins yields functional HP-NAP from E. coli in its native form with high yield and purity. The purified HP-NAP could be further utilized for the prevention, treatment, and prognosis of H. pylori-associated diseases as well as cancer therapy.

One-step Negative Chromatographic Purification of Helicobacter pylori Neutrophil-activating Protein Overexpressed in Escherichia coli in Batch Mode

A high yield method for one-step negative purification of recombinant Helicobacter pylori neutrophil-activating protein (HP-NAP) overexpressed in Escherichia coli by using diethylaminoethyl resins in batch mode is described. HP-NAP purified by this method is beneficial for the development of vaccines, drugs, or diagnostics for H. pylori-associated diseases.

De un solo paso negativo Purificación cromatográfica de<em&gt; Helicobacter pylori</em&gt; La proteína activadora de neutrófilos sobreexpresa en<em&gt; Escherichia coli</em&gt; En modo batch

Helicobacter pylori neutrophil-activating protein (HP-NAP) is a major virulence factor of Helicobacter pylori (H. pylori). It plays a critical role in H. ...

A Protocol to Characterize the Morphological Changes of Clostridium difficile in Response to Antibiotic Treatment

Assessment of antibiotic action with new drug development directed towards anaerobic bacteria is difficult and technically demanding. To gain insight into possible MOA, morphologic changes associated with antibiotic exposure can be visualized using scanning electron microscopy (SEM). Integrating SEM imaging with traditional kill curves may improve our insight into drug action and advance the drug development process. To test this premise, kill curves and SEM studies were conducted using drugs with known but different MOA (vancomycin and metronidazole). C. difficile cells (R20291) were grown with or without the presence of antibiotic for up to 48 h. Throughout the 48 h interval, cells were collected at multiple time points to determine antibiotic efficacy and for imaging on the SEM. Consistent with previous reports, vancomycin and metronidazole had significant bactericidal activity following 24 h of treatment as measured by colony-forming unit (CFU) counting. Using SEM imaging we determined that metronidazole had significant effects on cell length (&#62; 50% reduction in cell length for each antibiotic; P&#60; 0.05) compared to controls and vancomycin. While the phenotypic response to drug treatment has not been documented previously in this manner, they are consistent with the drug&#39;s MOA demonstrating the versatility and reliability of the imaging and measurements and the application of this technique for other experimental compounds.

A Protocol to Characterize the Morphological Changes of Clostridium difficile in Response to Antibiotic Treatment

Antibiotic efficacy is most commonly determined by conducting killing kinetic studies and measuring colony forming units (CFUs). By integrating scanning electron microscopy (SEM) with these standard methods, we can distinguish the pharmacological effects of treatment between different antibiotics.

Protocolo para Caracterizar los Cambios Morfológicos de<em&gt; Clostridium difficile</em&gt; En respuesta al tratamiento antibiótico

Assessment of antibiotic action with new drug development directed towards anaerobic bacteria is difficult and technically demanding. To gain insight into ...

Detection of Enterohemorrhagic Escherichia Coli Colonization in Murine Host by Non-invasive In Vivo Bioluminescence System

Enterohemorrhagic E. coli (EHEC) O157:H7, which is a foodborne pathogen that causesdiarrhea, hemorrhagic colitis (HS), and hemolytic uremic syndrome (HUS), colonize to the intestinal tract of humans. To study the detailed mechanism of EHEC colonization in vivo, it is essential to have animal models to monitor and quantify EHEC colonization. We demonstrate here a mouse-EHEC colonization model by transforming the bioluminescent expressing plasmid to EHEC to monitor and quantify EHEC colonization in living hosts. Animals inoculated with bioluminescence-labeled EHEC show intense bioluminescent signals in mice by detection with a non-invasive in vivo imaging system. After 1 and 2 days post infection, bioluminescent signals could still be detected in infected animals, which suggests that EHEC colonize in hosts for at least 2 days. We also demonstrate that these bioluminescent EHEC locate to mouse intestine, specifically in the cecum and colon, from ex vivo images. This mouse-EHEC colonization model may serve as a tool to advance the current knowledge of the EHEC colonization mechanism.

Detection of Enterohemorrhagic Escherichia Coli Colonization in Murine Host by Non-invasive In Vivo Bioluminescence System

A detailed protocol of a mouse model for enterohemorrhagic E. coli (EHEC) colonization by using bioluminescence-labeled bacteria is presented. The detection of these bioluminescent bacteria by a non-invasive in vivo imaging system in live animals can advance our current understanding of EHEC colonization.

Detección de la colonización de Escherichia Coli enterohemorrágica en anfitrión murino no invasiva In Vivo el sistema de bioluminiscencia

Enterohemorrhagic E. coli (EHEC) O157:H7, which is a foodborne pathogen that causesdiarrhea, hemorrhagic colitis (HS), and hemolytic uremic syndrome ...

Creation of a Dense Transposon Insertion Library Using Bacterial Conjugation in Enterobacterial Strains Such As Escherichia Coli or Shigella flexneri

Transposon mutagenesis is a method that allows gene disruption via the random genomic insertion of a piece of DNA called a transposon. The protocol below outlines a method for high efficiency transfer between bacterial strains of a plasmid harboring a transposon containing a kanamycin resistance marker. The plasmid-borne transposase is encoded by a variant tnp gene that inserts the transposon into the genome of the recipient strain with very low insertional bias. This method thus allows the creation of large mutant libraries in which transposons have been inserted into unique genomic positions in a recipient strain of either Escherichia coli or Shigella flexneri bacteria. By using bacterial conjugation, as opposed to other methods such as electroporation or chemical transformation, large libraries with hundreds of thousands of unique clones can be created. This yields high-density insertion libraries, with insertions occurring as frequently as every 4-6 base pairs in non-essential genes. This method is superior to other methods as it allows for an inexpensive, easy to use, and high efficiency method for the creation of a dense transposon insertion library. The transposon library can be used in downstream applications such as transposon sequencing (Tn-Seq), to infer genetic interaction networks, or more simply, in mutational (forward genetic) screens.

Creation of a Dense Transposon Insertion Library Using Bacterial Conjugation in Enterobacterial Strains Such As Escherichia Coli or Shigella flexneri

Presented here is a simple method for creating a high-density transposon insertion library in Escherichia coli or Shigella flexneri using bacterial conjugation. This protocol allows the creation of a collection of hundreds of thousands of unique mutants in bacteria by the random genomic insertion of a transposon.

Creación de un denso Transposon inserción biblioteca usando Conjugación bacteriana en cepas enterobacterianas tales como Escherichia Coli o Shigella flexneri

Transposon mutagenesis is a method that allows gene disruption via the random genomic insertion of a piece of DNA called a transposon. The protocol below ...

Overexpression and Purification of Human Cis-prenyltransferase in Escherichia coli

Prenyltransferases (PT) are a group of enzymes that catalyze chain elongation of allylic diphosphate using isopentenyl diphosphate (IPP) via multiple condensation reactions. DHDDS (dehydrodolichyl diphosphate synthase) is a eukaryotic long-chain cis-PT (forming cis double bonds from the condensation reaction) that catalyzes chain elongation of farnesyl diphosphate (FPP, an allylic diphosphate) via multiple condensations with isopentenyl diphosphate (IPP). DHDDS is of biomedical importance, as a non-conservative mutation (K42E) in the enzyme results in retinitis pigmentosa, ultimately leading to blindness. Therefore, the present protocol was developed in order to acquire large quantities of purified DHDDS, suitable for mechanistic studies. Here, the usage of protein fusion, optimized culture conditions and codon-optimization were used to allow the overexpression and purification of functionally active human DHDDS in E. coli. The described protocol is simple, cost-effective and time sparing. The homology of cis-PT among different species suggests that this protocol may be applied for other eukaryotic cis-PT as well, such as those involved in natural rubber synthesis.

Overexpression and Purification of Human Cis-prenyltransferase in Escherichia coli

A simple protocol for overexpression and purification of codon-optimized, human cis-prenyltransferase, under non-denaturing conditions, from Escherichia coli, is described, along with an enzymatic activity assay. This protocol can be generalized for production of other cis- prenyltransferase proteins in quantity and quality suitable for mechanistic studies.

Sobreexpresión y Purificación de Humanos<em&gt; Cis</em&gt; -preniltransferasa en<em&gt; Escherichia coli</em

Prenyltransferases (PT) are a group of enzymes that catalyze chain elongation of allylic diphosphate using isopentenyl diphosphate (IPP) via multiple ...

Using Enhanced Green Fluorescence Protein-expressing Escherichia Coli to Assess Mouse Peritoneal Macrophage Phagocytosis

This manuscript describes a simple and reproducible method to perform a phagocytosis assay. The first part of this method involves building a pET-SUMO-EGFP vector (SUMO = small ubiquitin-like modifier) and expressing enhanced green fluorescence protein (EGFP) in Escherichia coli (BL21DE). EGFP-expressing E. coli is coincubated with macrophages for 1 h at 37 &#176;C; the negative control group is incubated on ice for the same amount of time. Then, the macrophages are ready for assessment. The advantages of this technique include its simple and straightforward steps, and phagocytosis can be measured by both flow cytometer and fluorescence microscope. The EGFP-expressing E. coli are stable and display a strong fluorescence signal even after the macrophages are fixed with paraformaldehyde. This method is not only suitable for the assessment of macrophage cell lines or primary macrophages in vitro but also suitable for the evaluation of granulocyte and monocyte phagocytosis in peripheral blood mononuclear cells. The results show that the phagocytic capability of peritoneal macrophages from young (eight-week-old) mice is higher than that of macrophages from aged (16-month-old) mice. In summary, this method measures macrophage phagocytosis and is suitable for studying the innate immune system function.

Using Enhanced Green Fluorescence Protein-expressing Escherichia Coli to Assess Mouse Peritoneal Macrophage Phagocytosis

Here, we present a protocol to assess mouse peritoneal macrophage phagocytosis using enhanced green fluorescence protein-expressing Escherichia coli.