Diese Arbeit wurde durch das NIH (AI119813), die Inbetriebnahme von der University of Arkansas und die Auszeichnung von Arkansas Biosciences Institute unterstützt.

1. Site-verwiesene Mutagenese des Zielgens
Hinweis: MDH drückt sich unter T7 Promotor im pCDF-1 Vektor mit den CloDF13 Ursprung und Ausfertigung von 20 bis 4034eine eigene Nummer.
<ol><li>Einführung der Bernstein Stopcodon an der Position 140 im gen durch Primer (Grundierung weiterleiten: GGTGTTTATGACTAGAACAAACTGTTCGGCG und reverse Primer: GGCTTTTTTCAGCACTTCAGCAGCAATTGC), entsprechend den Anweisungen des Site-verwiesene Mutagenese Kit.</li>
	<li>Verstärken Sie die Vorlage Plasmid enthält das gen der Wildtyp Malat Dehydratase zu, und legen Sie die Stopp-Codon-Mutation durch die Polymerase-Kettenreaktion (PCR) Reaktion. Im Reaktionsgemisch, gehören 12,5 µL 2 X DNA-Polymerase-Enzym-Mix, 1,25 µL 10 µM Forward Primer, 1,25 µL 10 µM-rückwärts-Primer, 1 µL DNA-Vorlage (20 ng/µL) (pCDF-1 Plasmid enthält das gen der Wildtyp MDH), und 9 µL Nuklease-freies Wasser.<ol>
<li>PCR-Reaktion-Parameter wie folgt zu verwenden: initiale Denaturierung bei 98 ° C für 30 s; 25 Zyklen von 10 s bei 98 ° C, 30 s bei 55 ° C und 3 min bei 72 ° C; letzte Verlängerung bei 72 ° C für 3 Minuten. Fügen Sie nach PCR die verstärkte Material direkt an die Kinase-Ligase-DpnI Enzym-Mix aus dem Kit für 1 h bei Raumtemperatur Circularization und Vorlage zu entfernen. Hinweis: Das Reaktionsgemisch enthält 1 µL des PCR-Produkt, 5 µL 2 X Reaktion Puffer 1 µL 10 X Kinase-Ligase-DpnI Enzym-Mix und 3 µL Nuklease-freies Wasser.</li>
	</ol>
</li>
	<li>Fügen Sie 5 µL der Reaktion Mischung in das Röhrchen von 25 µL aufgetaut kompetente E. Coli DH5α Zellen aus dem Kit. Vorsichtig streichen Sie das Rohr zu mischen, und legen Sie die Mischung auf dem Eis für 30 min. Hitzeschock die Mischung bei 42 ° C für 30 s und Platz für weitere 5 min auf Eis.<ol>
<li>Pipette 600 µL der Raumtemperatur Optimal Super Brühe mit Catabolite Repression (SOC) Medien aus dem Kit in die Mischung, mit Schütteln bei 250 u/min bei 37 ° C für 60 min inkubieren, 100 µL auf ein Lysogeny Brühe (LB) Agarplatte mit dem entsprechenden Antibiotikum zu verbreiten , und über Nacht bei 37 ° C mit Schütteln bei 250 u/min inkubieren.</li>
	</ol>
</li>
	<li>Wählen Sie 4-6 einzelne Kolonien in 6 mL frisches LB-Medium mit dem entsprechenden Antibiotikum und Inkubation bei 37 ° C über Nacht mit 250 u/min schütteln. Extrahieren Sie Plasmide aus jede Nacht Kultur durch das Plasmid-Reinigung-Kit, nach Anleitung des Herstellers, dann senden Plasmide für DNA-Sequenzierung nach dem Protokoll des Service-providers, die Stopp-Codon Mutation an den richtigen Positionen zu bestätigen.</li>
	<li>Speichern Sie die Belastung mit der richtigen Reihenfolge bei-80 ° C durch das Mischen von 1 mL über Nacht Kultur und 300 µL 100 % DMSO.</li>
</ol>(2) Ausdruck des Proteins Schimmelpilzschäden
<ol><li>Legen Sie die Gene des optimierten Acetyllysyl-tRNA Synthestase33 und optimiert tRNAPyl 32 in der weder Plasmid. Legen Sie die tRNA Synthestase gen unter der konstitutiven Lpp -Promoter. Legen Sie die tRNA-gen unter die konstitutive ProK Promotor34.<ol>
<li>Co der Ausdruck Vektor34 mit TAG-haltigen mutierten Gens Malat-Dehydrogenase zu verwandeln, und das Plasmid beherbergen das optimierte Acetyllysine Aufnahme-System, in 25 µL aufgetauten kompetente E. Coli BL21(DE3) Zellen durch Hitzeschock bei 42 ° C für 10 s und Platz für weitere 5 min auf Eis.</li>
		<li>Pipette 600 µL Raumtemperatur SOC Medien in die Mischung, Inkubation bei 37 ° C für 60 min mit Schütteln bei 275 u/min, 100 µL auf einen Teller mit 100 µg/mL Streptomycin und 50 µg/mL Chloramphenicol zu verbreiten und über Nacht bei 37 ° C mit Schütteln bei 275 u/min inkubieren.</li>
	</ol>
</li>
	<li>Nehmen Sie eine einzige Kolonie von der Platte, und in 15 mL frisches LB-Medium mit 100 µg/mL Streptomycin und 50 µg/mL Chloramphenicol in einer 50 mL-Tube über Nacht bei 37 ° C unter Schütteln mit der Geschwindigkeit von 250 u/min zu impfen. Die 15 mL über Nacht Kultur auf 300 mL frisches LB Medien mit Antibiotika in eine 1 L Flasche übertragen und unter Schütteln bei 250 u/min bei 37 ° C inkubieren.</li>
	<li>Auflösen von Acetyllysine mit Wasser zu 100 mM Stammlösung, bei 4 ° c lagern Hinzufügen Acetyllysine 5 mM und 20 mM Nicotinamid (Hemmer der Deacetylases) die Wachstumsmedien erreicht Extinktion 0,5 bei 600 nm.<ol>
<li>Wachsen Sie Zellen für weitere 1 h bei 37 ° C, bei 250 u/min, schütteln dann fügen Sie 0,5 mM IPTG für Protein-Expression hinzu, und wachsen Sie Zellen bei 25 ° C über Nacht, mit 180 u/min schütteln. Hinweis: Der Ausdruck Bedingungen ggf. Optimierung für verschiedene Proteine.</li>
	</ol>
</li>
	<li>Sammeln Sie Zellen von 3.000 x g bei 4 ° C für 15 min Zentrifugieren, verwerfen Sie überstand und waschen Sie Zelle Pellets mit dem Phosphat-gepufferte Kochsalzlösung (PBS) Puffer (10 mM Na2HPO4, 1,8 mM KH2PO4, 137 mM NaCl, 2,7 mM KCl). Sammeln Sie gewaschene Zellen bei 10.000 x g bei 4 ° C für 5 min, verwerfen Sie den Überstand und speichern Sie Zelle Pellets bei-80 ° C.</li>
</ol>3. Reinigung von Schimmelpilzschäden Protein
<ol><li>Tauen Sie die gefrorenen Zellen Pellets auf Eis, und wieder mit 15 mL Lyse-Puffer (50 mM Tris (Hydroxymethyl) Aminomethane (Tris) pH 7,8, 300 mM NaCl, 20 mM Imidazol und Nicotinamid 20 mM), aussetzen Sie 5 µL des β-Mercaptoethanol und 1 µL Benzonase Nuklease (250 Einheiten).</li>
	<li>Zellen zu brechen, indem 40 kHz Beschallung bei 70 % Leistung mit 10 Zyklen von 10 s kurze Bursts, gefolgt von Abständen von 30 s für Abkühlung auf Rohöl Extrakt Form. Zentrifuge Roh extrahieren bei 20.000 x g für 25 min bei 4 ° C. Filtern des Überstands mit 0,45 µm Membranfilter, und laden Sie in eine Spalte mit 1 mL der Nickel-Nitrilotriacetic Säure (Ni-NTA) Harz mit 20 mL Wasser und 20 mL Lyse Puffer equilibriert. Hinweis: Zellen können auch durch milde Reinigungsmittel, gebrochen werden, wenn Beschallung nicht verfügbar ist.</li>
	<li>Waschen Sie die Spalte mit 20 mL Waschpuffer (50 mM Tris pH 7,8, 300 mM NaCl, 50 mM Imidazol und 20 mM Nicotinamid), und dann mit 2 mL Elution Buffer (50 mM Tris pH 7,8, 300 mM NaCl, 150 mM Imidazol und 20 mM Nicotinamid) eluieren.</li>
	<li>Entsalzen Sie den Elution Bruch mit Entsalzung Puffer (25 mM Tris pH 7,8 und 10 mM NaCl) die Spalte "PD-10", nach Anleitung des Herstellers. Messen Sie die Konzentration der eluierten Proteins durch entsprechend den Anweisungen des Bradford Protein Assay Reagenz. Das entsalzte Protein ist bereit für weitere Experimente. Hinweis: 50 % Glycerin Lager des Proteins, und bei-80 ° C für die Lagerung.</li>
</ol>(4) biochemische Charakterisierung des Schimmelpilzschäden Proteins
<ol><li>
SDS-PAGE und Mass Spectrometry Analysen.
	<ol>
<li>Denaturieren Proteine mit dem Sodium Dodecyl Sulfat (SDS) Probenpuffer (5 µL Protein Probe mit 2 µL 4 X SDS-Probenpuffer) in eine 2 mL-Tube bei 105 ° C für 5 min, Zentrifugieren Sie das Gemisch bei 2000 X g für 10 s, Last auf die 4-20 % Sodium Dodecyl Sulfat Polyacrylamid-Gel Electroph Oresis (SDS-PAGE) Gel und Lauf bei 200 V für 30 Minuten.</li>
		<li>Waschen Sie das Gel mit destilliertem Wasser und schütteln Sie sanft für 5 min, wiederholt den Vorgang 3 Mal. Entsorgen Sie das Wasser, und färben Sie das Gel mit Coomassie blaue Fleck für 1 h mit sanft schütteln. De-Fleck das Gel mit destilliertem Wasser, schütteln Sie sie leicht für 30 Minuten, und wiederholen Sie dies 3 Mal de-Fleck.</li>
		<li>Schneiden Sie die Band an 33 kDa auf dem Coomassie Blau gefärbten SDS-PAGE Gel, und senden Sie es an Massenspektrometrie Einrichtungen oder Unternehmen, um zu bestätigen, dass die Acetyllysine an der gestalteten Position aufgenommen wurde. Hinweis: Das Protokoll der Massenspektrometrie Analyse folgte der früheren Experiment34.</li>
	</ol>
</li>
	<li>
Westliche Beflecken
	<ol>
<li>Führen Sie die SDS-PAGE-Gel mit dem gleichen Protokoll im Schritt 4.1. Genießen Sie nach dem Gel laufen das Gel mit dem Transfer-Puffer (25 mM Tris, 192 mM Glycin pH 8,3 und 20 % Methanol) für 15 Minuten.</li>
		<li>Aktivieren Sie einer 0,2 µm, 7 x 8,5 cm Polyvinylidene Difluoride (PVDF) Membran mit Methanol für 1 min, und spülen Sie mit Transfer Puffer vor der Vorbereitung der Übertragung-Sandwich. Hinweis: Methanol ist gefährlich bei Hautkontakt, Blickkontakt, verschlucken oder einatmen. Schweren Überbelichtung kann zu Tod führen.</li>
		<li>Die Transfer-Sandwich von Kathode zu Anode (Schwamm, Filterpapier, SDS-PAGE Gel, PVDF Membran, Filterpapier und Schwamm) zu machen. Legen Sie den Stapel in den Transfer-Tank, laufen mit konstanter Strom von 350 mA für 45 Minuten. Hinweis: Der Transfer kann Optimierung benötigen.</li>
		<li>Waschen Sie die PVDF-Membran mit 25 mL Tris gepufferte Kochsalzlösung, 0,1 % Tween 20 (TBST) (137 mM NaCl, 20 mM Tris, 0,1 % Tween-20, pH 7.6) Puffer für 5 min mit sanft schütteln. Blockieren Sie die Membran mit 5 % Rinderserumalbumin (BSA) im TBST Puffer für 1 h bei Raumtemperatur.</li>
		<li>Inkubieren Sie die Membran mit HRP-konjugierten Acetyllysine-Antikörper mit einer Endkonzentration von 1 µg/mL verdünnt mit 5 % BSA in TBST bei 4 ° C über Nacht mit sanft schütteln. Hinweis: Für schnellere Ergebnisse könnte dieser Schritt in 1 h bei Raumtemperatur durchgeführt werden. Die Verdünnung der Antikörper kann Optimierung benötigen.</li>
		<li>Waschen Sie die Membran mit 20 mL TBST Puffer für 5 min mit sanft schütteln, wiederholen die Schritt 4 Mal. Gelten der Chemilumineszenz-Substrat für die Membran durch Anweisungen des Herstellers. Erfassen Sie das Signal mit einem Ladegerät – gekoppelt (CCD) Kamera-basierte Imager.</li>
	</ol>
</li>
</ol>

<ol>
	<li>Krishna, R. G., Wold, F. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Post-translational+modification+of+proteins.">Post-translational modification of proteins.</a> Adv Enzymol Relat Areas Mol Biol. 67, 265-298 (1993).</li><li>Lothrop, A. P., Torres, M. P., Fuchs, S. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Deciphering+post-translational+modification+codes.">Deciphering post-translational modification codes.</a> FEBS Lett. 587 (8), 1247-1257 (2013).</li><li>Walsh, C. T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=.">.</a> Posttranslational modification of proteins : expanding nature's inventory. , (2006).</li><li>Khoury, G. A., Baliban, R. C., Floudas, C. A. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Proteome-wide+post-translational+modification+statistics:+frequency+analysis+and+curation+of+the+swiss-prot+database.">Proteome-wide post-translational modification statistics: frequency analysis and curation of the swiss-prot database.</a> Sci Rep. 1, (2011).</li><li>Grotenbreg, G., Ploegh, H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Chemical+biology:+dressed-up+proteins.">Chemical biology: dressed-up proteins.</a> Nature. 446 (7139), 993-995 (2007).</li><li>Arif, M., Selvi, B. R., Kundu, T. K. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Lysine+acetylation:+the+tale+of+a+modification+from+transcription+regulation+to+metabolism.">Lysine acetylation: the tale of a modification from transcription regulation to metabolism.</a> Chembiochem. 11 (11), 1501-1504 (2010).</li><li>Cohen, T., Yao, T. P. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=AcK-knowledge+reversible+acetylation.">AcK-knowledge reversible acetylation.</a> Science's STKE : signal transduction knowledge environment. (245), pe42 (2004).</li><li>Drazic, A., Myklebust, L. M., Ree, R., Arnesen, T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+world+of+protein+acetylation.">The world of protein acetylation.</a> Biochim Biophys Acta. 1864 (10), 1372-1401 (2016).</li><li>Escalante-Semerena, J. C. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=N&#949;-acetylation+control+conserved+in+all+three+life+domains.">N&#949;-acetylation control conserved in all three life domains.</a> Microbe. 5, 340-344 (2010).</li><li>Kouzarides, T. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Acetylation:+a+regulatory+modification+to+rival+phosphorylation?.">Acetylation: a regulatory modification to rival phosphorylation?.</a> The EMBO journal. 19 (6), 1176-1179 (2000).</li><li>Soppa, J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protein+acetylation+in+archaea,+bacteria,+and+eukaryotes.">Protein acetylation in archaea, bacteria, and eukaryotes.</a> Archaea. , (2010).</li><li>Verdin, E., Ott, M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=50+years+of+protein+acetylation:+from+gene+regulation+to+epigenetics,+metabolism+and+beyond.">50 years of protein acetylation: from gene regulation to epigenetics, metabolism and beyond.</a> Nat Rev Mol Cell Biol. 16 (4), 258-264 (2015).</li><li>Allfrey, V. G., Faulkner, R., Mirsky, A. E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Acetylation+and+Methylation+of+Histones+and+Their+Possible+Role+in+the+Regulation+of+Rna+Synthesis.">Acetylation and Methylation of Histones and Their Possible Role in the Regulation of Rna Synthesis.</a> P Natl Acad Sci USA. 51, 786-794 (1964).</li><li>Phillips, D. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+presence+of+acetyl+groups+of+histones.">The presence of acetyl groups of histones.</a> Biochem j. 87, 258-263 (1963).</li><li>Sterner, D. E., Berger, S. L. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Acetylation+of+histones+and+transcription-related+factors.">Acetylation of histones and transcription-related factors.</a> Microbiology and molecular biology reviews: MMBR. 64 (2), 435-459 (2000).</li><li>Glozak, M. A., Sengupta, N., Zhang, X., Seto, E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Acetylation+and+deacetylation+of+non-histone+proteins.">Acetylation and deacetylation of non-histone proteins.</a> Gene. 363, 15-23 (2005).</li><li>Close, P., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=The+emerging+role+of+lysine+acetylation+of+non-nuclear+proteins.">The emerging role of lysine acetylation of non-nuclear proteins.</a> Cell Mol Life Sci. 67 (8), 1255-1264 (2010).</li><li>Iyer, A., Fairlie, D. P., Brown, L. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Lysine+acetylation+in+obesity,+diabetes+and+metabolic+disease.">Lysine acetylation in obesity, diabetes and metabolic disease.</a> Immunol Cell Biol. 90 (1), 39-46 (2012).</li><li>You, L., Nie, J., Sun, W. J., Zheng, Z. Q., Yang, X. J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Lysine+acetylation:+enzymes,+bromodomains+and+links+to+different+diseases.">Lysine acetylation: enzymes, bromodomains and links to different diseases.</a> Essays Biochem. 52, 1-12 (2012).</li><li>Bonnaud, E. M., Suberbielle, E., Malnou, C. E. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Histone+acetylation+in+neuronal+(dys)function.">Histone acetylation in neuronal (dys)function.</a> Biomol Concepts. 7 (2), 103-116 (2016).</li><li>Fukushima, A., Lopaschuk, G. D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Acetylation+control+of+cardiac+fatty+acid+beta-oxidation+and+energy+metabolism+in+obesity,+diabetes,+and+heart+failure.">Acetylation control of cardiac fatty acid beta-oxidation and energy metabolism in obesity, diabetes, and heart failure.</a> Biochim Biophys Acta. 1862 (12), 2211-2220 (2016).</li><li>Kaypee, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Aberrant+lysine+acetylation+in+tumorigenesis:+Implications+in+the+development+of+therapeutics.">Aberrant lysine acetylation in tumorigenesis: Implications in the development of therapeutics.</a> Pharmacol Ther. 162, 98-119 (2016).</li><li>Tapias, A., Wang, Z. Q. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Lysine+Acetylation+and+Deacetylation+in+Brain+Development+and+Neuropathies.">Lysine Acetylation and Deacetylation in Brain Development and Neuropathies.</a> Genomics Proteomics Bioinformatics. 15 (1), 19-36 (2017).</li><li>Hu, L. I., Lima, B. P., Wolfe, A. J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Bacterial+protein+acetylation:+the+dawning+of+a+new+age.">Bacterial protein acetylation: the dawning of a new age.</a> Molecular microbiology. 77 (1), 15-21 (2010).</li><li>Jones, J. D., O'Connor, C. D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protein+acetylation+in+prokaryotes.">Protein acetylation in prokaryotes.</a> Proteomics. 11 (15), 3012-3022 (2011).</li><li>Bernal, V., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Regulation+of+bacterial+physiology+by+lysine+acetylation+of+proteins.">Regulation of bacterial physiology by lysine acetylation of proteins.</a> New biotechnol. 31 (6), 586-595 (2014).</li><li>Hentchel, K. L., Escalante-Semerena, J. C. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Acylation+of+Biomolecules+in+Prokaryotes:+a+Widespread+Strategy+for+the+Control+of+Biological+Function+and+Metabolic+Stress.">Acylation of Biomolecules in Prokaryotes: a Widespread Strategy for the Control of Biological Function and Metabolic Stress.</a> Microbiology and molecular biology reviews : MMBR. 79 (3), 321-346 (2015).</li><li>Ouidir, T., Kentache, T., Hardouin, J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Protein+lysine+acetylation+in+bacteria:+Current+state+of+the+art.">Protein lysine acetylation in bacteria: Current state of the art.</a> Proteomics. 16 (2), 301-309 (2016).</li><li>Wolfe, A. J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Bacterial+protein+acetylation:+new+discoveries+unanswered+questions.">Bacterial protein acetylation: new discoveries unanswered questions.</a> Curr Genet. 62 (2), 335-341 (2016).</li><li>Albaugh, B. N., Arnold, K. M., Lee, S., Denu, J. M. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Autoacetylation+of+the+histone+acetyltransferase+Rtt109.">Autoacetylation of the histone acetyltransferase Rtt109.</a> J Biol Chem. 286 (28), 24694-24701 (2011).</li><li>Neumann, H., Peak-Chew, S. Y., Chin, J. W. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Genetically+encoding+N&#949;-acetyllysine+in+recombinant+proteins.">Genetically encoding N&#949;-acetyllysine in recombinant proteins.</a> Nat chem biol. 4 (4), 232-234 (2008).</li><li>Fan, C., Xiong, H., Reynolds, N. M., Soll, D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Rationally+evolving+tRNAPyl+for+efficient+incorporation+of+noncanonical+amino+acids.">Rationally evolving tRNAPyl for efficient incorporation of noncanonical amino acids.</a> Nucleic Acids Res. 43 (22), e156 (2015).</li><li>Bryson, D., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Continuous+directed+evolution+of+aminoacyl-tRNA+synthetases+to+alter+amino+acid+specificity+and+enhance+activity.">Continuous directed evolution of aminoacyl-tRNA synthetases to alter amino acid specificity and enhance activity.</a> Nat Chem Biol. , (2017).</li><li>Venkat, S., Gregory, C., Sturges, J., Gan, Q., Fan, C. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Studying+the+Lysine+Acetylation+of+Malate+Dehydrogenase.">Studying the Lysine Acetylation of Malate Dehydrogenase.</a> J Mol Biol. 429 (9), 1396-1405 (2017).</li><li>Venkat, S., Gregory, C., Gan, Q., Fan, C. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Biochemical+characterization+of+the+lysine+acetylation+of+tyrosyl-tRNA+synthetase+in+Escherichia+coli.">Biochemical characterization of the lysine acetylation of tyrosyl-tRNA synthetase in Escherichia coli.</a> Chembiochem. 18 (19), 1928-1934 (2017).</li><li>Liu, C. C., Schultz, P. G. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Adding+new+chemistries+to+the+genetic+code.">Adding new chemistries to the genetic code.</a> Annu Rev Biochem. 79, 413-444 (2010).</li><li>Mukai, T., Lajoie, M. J., Englert, M., Soll, D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Rewriting+the+Genetic+Code.">Rewriting the Genetic Code.</a> Annu Rev Microbiol. , (2017).</li><li>O'Donoghue, P., Ling, J., Wang, Y. S., Soll, D. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Upgrading+protein+synthesis+for+synthetic+biology.">Upgrading protein synthesis for synthetic biology.</a> Nat Chem Biol. 9 (10), 594-598 (2013).</li><li>Chin, J. W. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Expanding+and+reprogramming+the+genetic+code+of+cells+and+animals.">Expanding and reprogramming the genetic code of cells and animals.</a> Annu Rev Biochem. 83, 379-408 (2014).</li><li>O'Donoghue, P., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Near-cognate+suppression+of+amber,+opal+and+quadruplet+codons+competes+with+aminoacyl-tRNAPyl+for+genetic+code+expansion.">Near-cognate suppression of amber, opal and quadruplet codons competes with aminoacyl-tRNAPyl for genetic code expansion.</a> FEBS Lett. 586 (21), 3931-3937 (2012).</li><li>Aerni, H. R., Shifman, M. A., Rogulina, S., O'Donoghue, P., Rinehart, J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Revealing+the+amino+acid+composition+of+proteins+within+an+expanded+genetic+code.">Revealing the amino acid composition of proteins within an expanded genetic code.</a> Nucleic Acids Res. 43 (2), e8 (2015).</li><li>Huang, Y., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+convenient+method+for+genetic+incorporation+of+multiple+noncanonical+amino+acids+into+one+protein+in+Escherichia+coli.">A convenient method for genetic incorporation of multiple noncanonical amino acids into one protein in Escherichia coli.</a> Mol Biosyst. 6 (4), 683-686 (2010).</li><li>Venkat, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Genetically+encoding+thioacetyl-lysine+as+a+nondeacetylatable+analog+of+lysine+acetylation+in+Escherichia+coli.">Genetically encoding thioacetyl-lysine as a nondeacetylatable analog of lysine acetylation in Escherichia coli.</a> FEBS Open. , (2017).</li><li>Wan, W., Tharp, J. M., Liu, W. R. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Pyrrolysyl-tRNA+synthetase:+an+ordinary+enzyme+but+an+outstanding+genetic+code+expansion+tool.">Pyrrolysyl-tRNA synthetase: an ordinary enzyme but an outstanding genetic code expansion tool.</a> Biochim Biophys Acta. 1844 (6), 1059-1070 (2014).</li><li>Gregoretti, I. V., Lee, Y. M., Goodson, H. V. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Molecular+evolution+of+the+histone+deacetylase+family:+functional+implications+of+phylogenetic+analysis.">Molecular evolution of the histone deacetylase family: functional implications of phylogenetic analysis.</a> J Mol Biol. 338 (1), 17-31 (2004).</li><li>Weinert, B. T., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Acetyl-phosphate+is+a+critical+determinant+of+lysine+acetylation+in+E.+coli.">Acetyl-phosphate is a critical determinant of lysine acetylation in E. coli.</a> Mol cell. 51 (2), 265-272 (2013).</li></ol>

Die Autoren haben nichts preisgeben.

Die genetische Einbeziehung der noncanonical Aminosäuren (NcAAs) basiert auf der Unterdrückung der einen zugewiesenen Codon, meist die Bernstein Stopp-Codon UAG36,37,38,39, von der ncAA aufgeladen tRNA enthält die entsprechenden Anticodon. Wie bekannt ist, ist das UAG-Codon von den Release Faktor-1 (RF1) in Bakterien erkannt, und es kann auch unterdrückt werden, indem in der Nähe von cognate tRNAs von Hosts durch kanonische Aminosäuren (cAAs) aufgeladen wie Lysin und Tyrosin40,41. Insofern hängt die Effizienz der ncAA Einbindung in das UAG-Codon auf den Wettbewerb zwischen ncAA-geladene tRNAs und RF1, während die Reinheit der ncAA Gründung stützt sich auf den Wettbewerb zwischen den ncAA-geladene tRNAs und cAA-Rechnung in der Nähe von cognate tRNAs. Geringe Ausbeute und Reinheit des Zielproteins acetyliert können durch die geringe Einbeziehung Effizienz des orthogonalen Paares eingeführt in die Wirtszellen verursacht werden. Dieses Problem konnte gelöst werden, durch die Erhöhung der Konzentration des Acetyllysine in den Medien, und vor kurzem mit optimierten Acetyllysine Aufnahme-Systeme, die die UAG-Codon-Unterdrückung durch 58 mal32,33erhöht, sowohl die Effizienz und die Reinheit der Acetyllysine Aufnahme werden verbessert. Dargestellt in Abbildung 1 und Protein Erträge zu vergleichen die Effizienz der Acetyllysine Aufnahme wurde etwa 50 %, sowie gab es keine nachweisbaren Protein von Zellen beherbergen das AcK-Aufnahme-System und das mutierte Gen von MDH, aber ohne AcK in gereinigt Wachstumsmedien, die die hohe Reinheit des Acetyllysine Aufnahme angegeben. Darüber hinaus zeigen Massenspektrometrie Analyse auch keine cAAs an Position 140 von MDH, zeigt die Homogenität der Acetyllysine Aufnahme.
Es gibt zwei wesentliche Einschränkungen dieses Ansatzes. Erstens wegen der Konkurrenz der Acetyllysine aufgeladen tRNA mit beiden RF1 und cAA-geladene nahe verwandten tRNAs oben beschrieben, die maximale Anzahl der Acetyllysine Rückstände, die gleichzeitig in ein einziges Protein aufgenommen werden können derzeit drei 33,42. Zweitens haben Zellen anderer Arten von Deacetylases, das Nicotinamid zu widerstehen und können bestimmte Zielproteine deacetylate. Also, können diese Proteine nicht 100 % Acetylierung an bestimmten Standorten erreichen. Kürzlich haben wir ein Thio-Acetyllysine-Aufnahme-System, das als ein nicht-deacetylable Analog der Acetyllysine43genutzt werden kann, damit dieses System wäre ein guter alternativer Ansatz in diesem Fall.
Wie bereits erwähnt, ist der klassische Ansatz zum biochemisch Lysin Acetylierung charakterisieren Site-verwiesene Mutagenese verwenden. Glutamin dient als eine Imitation des Acetyllysine und Arginin ist als ein nicht acetyliert Lysin Mimic genutzt. Beide Mimik sind jedoch nicht real Isosteres, und nicht immer die erwarteten Ergebnisse30Ausbeute. Die genetische Code Expansionsstrategie konnte homogen Schimmelpilzschäden Proteine an bestimmten Lysin Rückstände, generieren die strengsten geht es um Schimmelpilzschäden Proteine zu charakterisieren.
Das genetische Aufnahme-System für Acetyllysine wurde aus dem Paar Pyrrolysyl-tRNA Synthestase Varianten und ihre Verwandten tRNA von Methanosarcinaceae Arten, die auch bekannt ist als orthogonal in Eukaryoten44abgeleitet. Frühere Studien haben gezeigt, dass dieses System in Säugetierzellen und bestimmte Tiere für Protein Acetylierung Studien39angewandt werden, so könnte dieses Protokolls Säugerzellen und sogar Tiere für größere Anwendungen in der Medizintechnik erweitert werden Forschung und Industrie. Darüber hinaus ist dieses Protokoll auch im Wesentlichen dasselbe Protokoll verwendet, um verschiedene Arten von NcAAs, erfordern eine einfache Änderung der orthogonalen paar eingeführt in die Wirtszellen zu integrieren.
Lysin Deacetylases (KDACs) entfernen Sie die Acetyl-Gruppe aus der Schimmelpilzschäden Lysin Rückstand in Proteine45. Die Sirtuin-Typ CobB ist der nur bekannte Deacetylase in E. Coli, die von Nicotinamid27gehemmt werden kann. Also, sollte zur Vermeidung der Deacetylation von Schimmelpilzschäden Protein erzeugt beim Zellwachstum und Proteinreinigung 20 bis 50 mM Nicotinamid in Wachstumsmedien und Reinigung Puffer hinzugefügt werden. Einmal gereinigt, ist Acetylierung von Lysin Rückstände aufgrund fehlender Deacetylase relativ stabil. Zweitens, um den Hintergrund der unspezifischen Acetylierung auf andere Lysin Rückstände des Proteins, die BL21 zu senken (DE3) Belastung der Ausdruck Belastung aufgrund seiner deutlich geringeren Protein Acetylierung als häufig verwendete K12-abgeleitete Stämme46 diente als . Wie in Abbildung 2dargestellt, hatte der Wildtyp MDH von BL21(DE3) Zellen ausgedrückt keine nachweisbaren Acetylierung durch westliche Beflecken. Dies ist ein weiterer wichtiger Faktor, um die Reinheit der Acetylierung in das Zielprotein zu erhöhen.

Post-translationalen Modifikationen (PTMs) von Proteinen auftreten, nachdem Sie den Übersetzungsprozess und entstehen durch kovalente Zugabe von funktionellen Gruppen zu Aminosäurereste, spielen eine wichtige Rolle in fast allen biologischen Prozessen, einschließlich gen Transkription, Stress-Reaktion, Zelldifferenzierung und Stoffwechsel1,2,3. Bis heute wurden etwa 400 unverwechselbaren wurden PTMs identifizierten4. Die Komplexität des Genoms und die Proteome wird zu einem großen Teil durch Protein PTMs verstärkt, wie sie Proteinaktivität und Lokalisierung zu regulieren, und die Interaktion mit anderen Molekülen wie Proteinen, Nukleinsäuren und Lipiden Cofaktoren5 beeinflussen.
Protein-Acetylierung wurde an der Spitze der PTMs Studien in den letzten zwei Jahrzehnten6,7,8,9,10,11,12. Lysin Acetylierung wurde zuerst in Histone vor mehr als 50 Jahren entdeckt,13,14, wurde auch geprüft, und ist bekannt in mehr als 80 Transkriptionsfaktoren, Regulatoren und verschiedene Proteine15vorhanden sein, 16,17. Studien über Protein Acetylierung haben nicht nur uns ein tieferes Verständnis für seine Regulationsmechanismen zur Verfügung gestellt, aber auch Behandlungen für eine Reihe von Krankheiten, die durch dysfunktionalen Acetylierung18,19, geführt 20 , 21 , 22 , 23. glaubte man, dass Lysin Acetylierung nur in Eukaryoten geschieht, aber neuere Studien gezeigt haben, dass Protein Acetylierung spielt auch Schlüsselrollen in der bakteriellen Physiologie einschließlich Chemotaxis, Säurebeständigkeit, Aktivierung und Stabilisierung der im Zusammenhang mit Proteinen24,25,26,27,28,29, Pathogenitätsinseln und andere Virulenz.
Eine häufig verwendete Methode, biochemisch Lysin Acetylierung zu charakterisieren ist Site-verwiesene Mutagenese verwendet. Glutamin dient als eine Imitation des Acetyllysine wegen der ähnlichen Größe und Polarität. Arginin wird als ein nicht acetyliert Lysin Mimic genutzt, da es seine positiven Ladung unter physiologischen Bedingungen bewahrt aber kann nicht acetyliert. Jedoch beide Mimik sind nicht real Isosteres und nicht immer die erwarteten Ergebnisse30Ausbeute. Der strengste Ansatz soll homogen Schimmelpilzschäden Proteine an bestimmten Lysin Rückstände zu generieren, das ist schwierig oder unmöglich für die meisten klassischen Methoden aufgrund der niedrigen Stöchiometrie von Lysin Acetylierung in Natur7,11. Diese Herausforderung hat durch den genetischen Code Expansionsstrategie, die ein veränderter Pyrrolysyl-tRNA Synthestase beschäftigt entwirrt worden Variante von Methanosarcinaceae Arten tRNA aufladenPyl mit Acetyllysine, nutzt den Host Translationale Maschinen zu unterdrücken, die UAG Codon in der mRNA zu stoppen und leitet die Einbeziehung von Acetyllysine in der gestalteten Position der Ziel-Protein-31. Vor kurzem haben wir dieses System mit einer verbesserten EF-Tu-Bindung tRNA-32 und eine verbesserte Acetyllysyl-tRNA Synthestase33optimiert. Darüber hinaus haben wir dieses System verbesserte Einbindung in Acetylierung Studien Malate Dehydrogenase34 und Tyrosyl-tRNA Synthestase35angewandt. Hier zeigen wir das Protokoll zur Erzeugung von rein Schimmelpilzschäden Proteine aus der molekularen Klonen biochemische Identifizierung mithilfe von Malat-Dehydrogenase (MDH), die wir als demonstratives Beispiel ausgiebig studiert haben.

<table border="0" cellpadding="0" cellspacing="0" width="615">
	<tbody>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">Bradford protein assay</td>
			<td style="width:113px;">Bio-Rad</td>
			<td style="width:119px;">5000006</td>
			<td style="width:167px;">Protein concentration</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">4x Laemmli Sample Buffer</td>
			<td style="width:113px;">Bio-Rad</td>
			<td style="width:119px;">1610747</td>
			<td style="width:167px;">SDS sample buffer</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">Coomassie G-250 Stain</td>
			<td style="width:113px;">Bio-Rad</td>
			<td style="width:119px;">1610786</td>
			<td style="width:167px;">SDS-PAGE gel staining</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">4-20% SDS-PAGE ready gel</td>
			<td style="width:113px;">Bio-Rad</td>
			<td style="width:119px;">4561093</td>
			<td style="width:167px;">Protein determination</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">Ac-K-100 (HRP Conjugate)</td>
			<td style="width:113px;">Cell Signaling</td>
			<td style="width:119px;">6952</td>
			<td style="width:167px;">Antibody</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">IPTG</td>
			<td style="width:113px;">CHEM-IMPEX</td>
			<td style="width:119px;">194</td>
			<td style="width:167px;">Expression inducer</td>
		</tr>
		<tr height="23">
			<td height="23" style="height:23px;width:216px;">N&#949;-Acetyl-L-lysine</td>
			<td style="width:113px;">CHEM-IMPEX</td>
			<td style="width:119px;">5364</td>
			<td style="width:167px;">Noncanonical amino acid</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">PD-10 desalting column</td>
			<td style="width:113px;">GE Healthcare</td>
			<td style="width:119px;">17085101</td>
			<td style="width:167px;">Desalting</td>
		</tr>
		<tr height="40">
			<td height="40" style="height:40px;width:216px;">Q5 Site-Directed Mutagenesis Kit</td>
			<td style="width:113px;">NEB</td>
			<td style="width:119px;">E0554</td>
			<td style="width:167px;">Introducing the stop codon</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">BL21 (DE3) cells</td>
			<td style="width:113px;">NEB</td>
			<td style="width:119px;">C2527</td>
			<td style="width:167px;">Expressing strain</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">QIAprep Spin Miniprep Kit</td>
			<td style="width:113px;">QIAGEN</td>
			<td style="width:119px;">27106</td>
			<td style="width:167px;">Extracting plasmids</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">Ni-NTA resin</td>
			<td style="width:113px;">QIAGEN</td>
			<td style="width:119px;">30210</td>
			<td style="width:167px;">Affinity purification resin</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">nicotinamide</td>
			<td style="width:113px;">Sigma-Aldrich</td>
			<td style="width:119px;">N3376</td>
			<td style="width:167px;">Deacetylase inhibitor</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">&#946;-Mercaptoethanol</td>
			<td style="width:113px;">Sigma-Aldrich</td>
			<td style="width:119px;">M6250</td>
			<td style="width:167px;">Reducing agent</td>
		</tr>
		<tr height="40">
			<td height="40" style="height:40px;width:216px;">BugBuster Protein Extraction Reagent</td>
			<td style="width:113px;">Sigma-Aldrich</td>
			<td style="width:119px;">70584</td>
			<td style="width:167px;">Breaking cells</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">Benzonase nuclease</td>
			<td style="width:113px;">Sigma-Aldrich</td>
			<td style="width:119px;">E1014</td>
			<td style="width:167px;">DNase</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">ECL Western Blotting Substrate</td>
			<td style="width:113px;">ThermoFisher</td>
			<td style="width:119px;">32106</td>
			<td style="width:167px;">Chemiluminescence</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">Premixed LB Broth</td>
			<td style="width:113px;">VWR</td>
			<td style="width:119px;">97064</td>
			<td style="width:167px;">Cell growth medium</td>
		</tr>
		<tr height="20">
			<td height="20" style="height:20px;width:216px;">Bovine serum albumin</td>
			<td style="width:113px;">VWR</td>
			<td style="width:119px;">97061-416</td>
			<td style="width:167px;">western blots blocking</td>
		</tr>
	</tbody>
</table>

a facile protocol to generate site-specifically acetylated proteins in escherichia coli

Post-translationalen Modifikationen, die an bestimmten Positionen von Proteinen entstehen nachweislich in einer Vielzahl von zellulären Prozessen eine wichtige Rolle spielen. Unter ihnen ist eines der am weitesten verbreitete reversible Lysin Acetylierung in allen Bereichen des Lebens. Obwohl zahlreiche Massenspektrometrie-basierte Acetylome Studien durchgeführt worden, weitere wurde Charakterisierung dieser vermeintlichen Acetylierung Ziele beschränkt. Ein möglicher Grund ist, dass es schwierig ist, rein Schimmelpilzschäden Proteine an den gewünschten Positionen durch die meisten klassischen biochemischen Ansätzen zu generieren. Um diese Herausforderung zu meistern, hat die genetischen Code Ausbau Technik angewendet, um das Paar ein veränderter Pyrrolysyl-tRNA Synthestase Variante und seine Verwandten tRNA von Methanosarcinaceae Arten verwenden, um die cotranslational Aufnahme leiten der Acetyllysine auf der Website des Proteins des Interesses. Nach der ersten Anwendung in der Studie von Histon Acetylierung hat dieser Ansatz Acetylierung Studien auf einer Vielzahl von Proteinen erleichtert. In dieser Arbeit haben wir eine einfache Protokoll zur ortspezifisch Schimmelpilzschäden Proteine zu produzieren, mit dem Modell Bakterium Escherichia coli als Gastgeber gezeigt. Malat-Dehydrogenase diente als ein Demo-Beispiel in diesem Werk.

Die Ausbeute an Schimmelpilzschäden MDH Protein war 15 mg pro 1 L Kultur, während das Wildtyp MDH 31 mg pro 1 L Kultur war. Gereinigten Proteine wurden von SDS-PAGE analysiert, wie in Abbildung 1dargestellt. Der Wildtyp MDH diente als eine Positivkontrolle34. Das Protein gereinigt von Zellen beherbergen das Acetyllysine (AcK)-Aufnahme-System und das mutierte Mdh -gen, aber ohne AcK im Wachstumsmedium, diente als Negativkontrolle. Lysin Acetylierung der gereinigten Proteine wurde erkannt, durch western Blot mit der Acetyllysine-Antikörper, wie in Abbildung 2dargestellt. Die Acetylierung des Lysin Rückstands 140 im Malat-Dehydrogenase bestätigte Tandem Massenspektrometrie Analyse wie in Abbildung 3dargestellt.
Die Proteinsequenz MDH Protein (das Fragment für Tandem-MS-Analyse ist in Fettdruck):
MKVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSGEDAT PALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAA EVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQVPGV SFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVVECAY VEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAFEQNALEGMLDTLKKDIALGEEFVNK
Die Proteinsequenz optimierte Acetyllysyl-tRNA Synthestase33:
MDKKPLDVLISATGLWMSRTGTLHKIKHYEISRSKIYIEMACGDHLVVNNSRSCRPARAFRYHKY RKTCKRCRVSDEDINNFLTRSTEGKTSVKVKVVSEPKVKKAMPKSVSRAPKPLENPVSAKAST DTSRSVPSPAKSTPNSPVPTSASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRR KKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKN FCLRPMMAPNLLNYARKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCTRE NLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGF GLERLLKVKHDFKNIKRAARSESYYNGISTNL
Die Gensequenz des optimierten tRNAPyl 32:
GGAAACGTGATCATGTAGATCGAATGGACTCTAAATCCGTTCAGTGGGGTTAGATTCCCC ACGTTTCCGCCA
<img alt="Figure 1" class="xfigimg" src="/files/ftp_upload/57061/57061fig1.jpg"> Abbildung 1 : The Coomassie Blau gefärbten SDS-PAGE Gel der gereinigten Full-length MDH und seine AcK-haltigen Variante. Gel-die gleiche Volumina der Elution, die Fraktionen auf die SDS-PAGE geladen wurden. <a href="//cloudflare-jove-com.remotexs.ntu.edu.sg/files/ftp_upload/57061/57061fig1large.jpg" target="_blank">Bitte klicken Sie hier für eine größere Version dieser Figur.</a>
<img alt="Figure 2" class="xfigimg" src="/files/ftp_upload/57061/57061fig2.jpg"> Abbildung 2 : Das westliche Beflecken der gereinigten Wildtyp MDH und seine AcK-haltigen Variante. Die gleiche Volumina der Elution Brüche wurden geladen. <a href="//cloudflare-jove-com.remotexs.ntu.edu.sg/files/ftp_upload/57061/57061fig2large.jpg" target="_blank">Bitte klicken Sie hier für eine größere Version dieser Figur.</a>
<img alt="Figure 3" class="xfigimg" src="/files/ftp_upload/57061/57061fig3.jpg"> Abbildung 3 : LC-MS/MS-Analyse der AcK-haltigen MDH Variante. Das Tandem Massenspektrum des Peptids (Rückstände 135-142) AGVYDKACNK aus gereinigtem Schimmelpilzschäden MDH-Variante. K-AC bezeichnet AcK Aufnahme. Die Teilsequenz des Peptids, enthält das AcK kann aus dem kommentierten b oder y Ion Serie gelesen werden. Aufeinander abgestimmte Gipfel waren rot. <a href="//cloudflare-jove-com.remotexs.ntu.edu.sg/files/ftp_upload/57061/57061fig3large.jpg" target="_blank">Bitte klicken Sie hier für eine größere Version dieser Figur.</a>

Watch this Scientific Journal Video about A Facile Protocol to Generate Site-Specifically Acetylated Proteins in Escherichia Coli at JoVE.com

A Facile Protocol to Generate Site-Specifically Acetylated Proteins in Escherichia Coli

Erweiterung des genetischen Codes dient als ein mächtiges Werkzeug für eine Vielzahl von biologischen Prozessen, einschließlich Protein Acetylierung zu studieren. Hier zeigen wir, dass eine einfache Protokoll nutzen diese Technik zur Erzeugung von homogen Proteine an bestimmten Standorten in Escherichia coli Zellen acetyliert.

Eine einfache Protokoll ortspezifisch generieren acetyliert Proteine in Escherichia Coli

Post-translational modifications that occur at specific positions of proteins have been shown to play important roles in a variety of cellular processes. ...

a-facile-protocol-to-generate-site-specifically-acetylated-proteins

Nanyang Technological University

Research

JoVE Journal

Immunology and Infection

A Facile Protocol to Generate Site-Specifically Acetylated Proteins in Escherichia Coli

6.8K Aufrufe.  University of Arkansas. Erweiterung des genetischen Codes dient als ein mächtiges Werkzeug für eine Vielzahl von biologischen Prozessen, einschließlich Protein Acetylierung zu studieren. Hier zeigen wir, dass eine einfache Protokoll nutzen diese Technik zur Erzeugung von homogen Proteine an bestimmten Standorten in Escherichia coli Zellen acetyliert.

Serie: A Facile Protocol to Generate Site-Specifically Acetylated Proteins in Escherichia Coli

Using Fluorescent Proteins to Visualize and Quantitate Chlamydia Vacuole Growth Dynamics in Living Cells

The obligate intracellular bacterium Chlamydia elicits a great burden on global public health. C.&#160;trachomatis is the leading bacterial cause of sexually transmitted infection and also the primary cause of preventable blindness in the world. An essential determinant for successful infection of host cells by Chlamydia is the bacterium's ability to manipulate host cell signaling from within a novel, vacuolar compartment called the inclusion. From within the inclusion, Chlamydia acquire nutrients required for their 2-3 day developmental growth, and they additionally secrete a panel of effector proteins onto the cytosolic face of the vacuole membrane and into the host cytosol. Gaps in our understanding of Chlamydia biology, however, present significant challenges for visualizing and analyzing this intracellular compartment. Recently, a reverse-imaging strategy for visualizing the inclusion using GFP expressing host cells was described. This approach rationally exploits the intrinsic impermeability of the inclusion membrane to large molecules such as GFP. In this work, we describe how GFP- or mCherry-expressing host cells are generated for subsequent visualization of chlamydial inclusions. Furthermore, this method is shown to effectively substitute for costly antibody-based enumeration methods, can be used in tandem with other fluorescent labels, such as GFP-expressing Chlamydia, and can be exploited to derive key quantitative data about inclusion membrane growth from a range of Chlamydia species and strains.

Using Fluorescent Proteins to Visualize and Quantitate Chlamydia Vacuole Growth Dynamics in Living Cells

A live cell fluorescent protein based method for illuminating cellular vacuoles (inclusions) containing Chlamydia is described. This strategy enables rapid, automated determination of Chlamydia infectivity in samples and can be used to quantitatively investigate inclusion growth dynamics.

Verwendung Fluoreszierende Proteine, zu visualisieren und zu quantifizieren<em&gt; Chlamydia</em&gt; Vakuole Wachstumsdynamik in lebenden Zellen

The obligate intracellular bacterium Chlamydia elicits a great burden on global public health. C.&#160;trachomatis is the leading bacterial cause of ...

Forschung

Immunologie und Infektion

A Protocol to Infect Caenorhabditis elegans with Salmonella typhimurium

In the last decade, C. elegans has emerged as an invertebrate organism to study interactions between hosts and pathogens, including the host defense against gram-negative bacterium Salmonella typhimurium. Salmonella establishes persistent infection in the intestine of C. elegans and results in early death of infected animals. A number of immunity mechanisms have been identified in C. elegans to defend against Salmonella infections. Autophagy, an evolutionarily conserved lysosomal degradation pathway, has been shown to limit the Salmonella replication in C. elegans and in mammals. Here, a protocol is described to infect C. elegans with Salmonella typhimurium, in which the worms are exposed to Salmonella for a limited time, similar to Salmonella infection in humans. Salmonella infection significantly shortens the lifespan of C. elegans. Using the essential autophagy gene bec-1 as an example, we combined this infection method with C. elegans RNAi feeding approach and showed this protocol can be used to examine the function of C. elegans host genes in defense against Salmonella infection. Since C. elegans whole genome RNAi libraries are available, this protocol makes it possible to comprehensively screen for C. elegans genes that protect against Salmonella and other intestinal pathogens using genome-wide RNAi libraries.

A Protocol to Infect Caenorhabditis elegans with Salmonella typhimurium

C. elegans has emerged as a new genetic model to study host-pathogen interactions. Here we describe a protocol to infect C. elegans with Salmonella typhimurium coupled with the double-strand RNAi interference technique to examine the role of host genes in defense against Salmonella infection.

Ein Protokoll zum Infect<em&gt; Caenorhabditis elegans</em&gt; Mit<em&gt; Salmonella typhimurium</em

In the last decade, C. elegans has emerged as an invertebrate organism to study interactions between hosts and pathogens, including the host defense ...

Non-Invasive Model of Neuropathogenic Escherichia coli Infection in the Neonatal Rat

Investigation of the interactions between animal host and bacterial pathogen is only meaningful if the infection model employed replicates the principal features of the natural infection. This protocol describes procedures for the establishment and evaluation of systemic infection due to neuropathogenic Escherichia coli K1 in the neonatal rat. Colonization of the gastrointestinal tract leads to dissemination of the pathogen along the gut-lymph-blood-brain course of infection and the model displays strong age dependency. A strain of E. coli O18:K1 with enhanced virulence for the neonatal rat produces exceptionally high rates of colonization, translocation to the blood compartment and invasion of the meninges following transit through the choroid plexus. As in the human host, penetration of the central nervous system is accompanied by local inflammation and an invariably lethal outcome. The model is of proven utility for studies of the mechanism of pathogenesis, for evaluation of therapeutic interventions and for assessment of bacterial virulence.

Non-Invasive Model of Neuropathogenic Escherichia coli Infection in the Neonatal Rat

Here, a procedure is described for the establishment of systemic infection in the neonatal rat with cultures of Escherichia coli K1. This non-invasive procedure permits colonization of the gastrointestinal tract, translocation of the pathogen to the systemic circulation, and invasion of the central nervous system at the choroid plexus.

Nichtinvasive Modell Neuropathogenic<em&gt; Escherichia coli</em&gt; Infektion in der neonatalen Ratten

Investigation of the interactions between animal host and bacterial pathogen is only meaningful if the infection model employed replicates the principal ...

Phage Phenomics: Physiological Approaches to Characterize Novel Viral Proteins

Current investigations into phage-host interactions are dependent on extrapolating knowledge from (meta)genomes. Interestingly, 60 - 95% of all phage sequences share no homology to current annotated proteins. As a result, a large proportion of phage genes are annotated as hypothetical. This reality heavily affects the annotation of both structural and auxiliary metabolic genes. Here we present phenomic methods designed to capture the physiological response(s) of a selected host during expression of one of these unknown phage genes. Multi-phenotype Assay Plates (MAPs) are used to monitor the diversity of host substrate utilization and subsequent biomass formation, while metabolomics provides bi-product analysis by monitoring metabolite abundance and diversity. Both tools are used simultaneously to provide a phenotypic profile associated with expression of a single putative phage open reading frame (ORF). Representative results for both methods are compared, highlighting the phenotypic profile differences of a host carrying either putative structural or metabolic phage genes. In addition, the visualization techniques and high throughput computational pipelines that facilitated experimental analysis are presented.

Here, we present phenomic approaches for the functional characterization of putative phage genes. Techniques include a developed assay capable of monitoring host anabolic metabolism, the Multi-phenotype Assay Plates (MAPs), in addition to the established method of metabolomics, capable of measuring effects to catabolic metabolism.

Phage Phenomics: Physiologische Ansätze zur Charakterisierung Novel virale Proteine

Current investigations into phage-host interactions are dependent on extrapolating knowledge from (meta)genomes. Interestingly, 60 - 95% of all phage ...

One-step Negative Chromatographic Purification of Helicobacter pylori Neutrophil-activating Protein Overexpressed in Escherichia coli in Batch Mode

Helicobacter pylori neutrophil-activating protein (HP-NAP) is a major virulence factor of Helicobacter pylori (H. pylori). It plays a critical role in H. pylori-induced gastric inflammation by activating several innate leukocytes including neutrophils, monocytes, and mast cells. The immunogenic and immunomodulatory properties of HP-NAP make it a potential diagnostic and vaccine candidate for H. pylori and a new drug candidate for cancer therapy. In order to obtain substantial quantities of purified HP-NAP used for its clinical applications, an efficient method to purify this protein with high yield and purity needs to be established.
In this protocol, we have described a method for one-step negative chromatographic purification of recombinant HP-NAP overexpressed in Escherichia coli (E. coli) by using diethylaminoethyl (DEAE) ion-exchange resins (e.g., Sephadex) in batch mode. Recombinant HP-NAP constitutes nearly 70% of the total protein in E. coli and is almost fully recovered in the soluble fraction upon cell lysis at pH 9.0. Under the optimal condition at pH 8.0, the majority of HP-NAP is recovered in the unbound fraction while the endogenous proteins from E. coli are efficiently removed by the resin.
This purification method using negative mode batch chromatography with DEAE ion-exchange resins yields functional HP-NAP from E. coli in its native form with high yield and purity. The purified HP-NAP could be further utilized for the prevention, treatment, and prognosis of H. pylori-associated diseases as well as cancer therapy.

One-step Negative Chromatographic Purification of Helicobacter pylori Neutrophil-activating Protein Overexpressed in Escherichia coli in Batch Mode

A high yield method for one-step negative purification of recombinant Helicobacter pylori neutrophil-activating protein (HP-NAP) overexpressed in Escherichia coli by using diethylaminoethyl resins in batch mode is described. HP-NAP purified by this method is beneficial for the development of vaccines, drugs, or diagnostics for H. pylori-associated diseases.

Ein-Schritt-Negative chromatographischer Reinigung von<em&gt; Helicobacter pylori</em&gt; Neutrophil-aktivierendes Protein überexprimiert in<em&gt; Escherichia coli</em&gt; Im Batch-Modus

Helicobacter pylori neutrophil-activating protein (HP-NAP) is a major virulence factor of Helicobacter pylori (H. pylori). It plays a critical role in H. ...

A Protocol to Characterize the Morphological Changes of Clostridium difficile in Response to Antibiotic Treatment

Assessment of antibiotic action with new drug development directed towards anaerobic bacteria is difficult and technically demanding. To gain insight into possible MOA, morphologic changes associated with antibiotic exposure can be visualized using scanning electron microscopy (SEM). Integrating SEM imaging with traditional kill curves may improve our insight into drug action and advance the drug development process. To test this premise, kill curves and SEM studies were conducted using drugs with known but different MOA (vancomycin and metronidazole). C. difficile cells (R20291) were grown with or without the presence of antibiotic for up to 48 h. Throughout the 48 h interval, cells were collected at multiple time points to determine antibiotic efficacy and for imaging on the SEM. Consistent with previous reports, vancomycin and metronidazole had significant bactericidal activity following 24 h of treatment as measured by colony-forming unit (CFU) counting. Using SEM imaging we determined that metronidazole had significant effects on cell length (&#62; 50% reduction in cell length for each antibiotic; P&#60; 0.05) compared to controls and vancomycin. While the phenotypic response to drug treatment has not been documented previously in this manner, they are consistent with the drug&#39;s MOA demonstrating the versatility and reliability of the imaging and measurements and the application of this technique for other experimental compounds.

A Protocol to Characterize the Morphological Changes of Clostridium difficile in Response to Antibiotic Treatment

Antibiotic efficacy is most commonly determined by conducting killing kinetic studies and measuring colony forming units (CFUs). By integrating scanning electron microscopy (SEM) with these standard methods, we can distinguish the pharmacological effects of treatment between different antibiotics.

Ein Protokoll zur Charakterisierung der morphologischen Veränderungen von<em&gt; Clostridium difficile</em&gt; In Antwort auf Antibiotika-Behandlung

Assessment of antibiotic action with new drug development directed towards anaerobic bacteria is difficult and technically demanding. To gain insight into ...

Detection of Enterohemorrhagic Escherichia Coli Colonization in Murine Host by Non-invasive In Vivo Bioluminescence System

Enterohemorrhagic E. coli (EHEC) O157:H7, which is a foodborne pathogen that causesdiarrhea, hemorrhagic colitis (HS), and hemolytic uremic syndrome (HUS), colonize to the intestinal tract of humans. To study the detailed mechanism of EHEC colonization in vivo, it is essential to have animal models to monitor and quantify EHEC colonization. We demonstrate here a mouse-EHEC colonization model by transforming the bioluminescent expressing plasmid to EHEC to monitor and quantify EHEC colonization in living hosts. Animals inoculated with bioluminescence-labeled EHEC show intense bioluminescent signals in mice by detection with a non-invasive in vivo imaging system. After 1 and 2 days post infection, bioluminescent signals could still be detected in infected animals, which suggests that EHEC colonize in hosts for at least 2 days. We also demonstrate that these bioluminescent EHEC locate to mouse intestine, specifically in the cecum and colon, from ex vivo images. This mouse-EHEC colonization model may serve as a tool to advance the current knowledge of the EHEC colonization mechanism.

Detection of Enterohemorrhagic Escherichia Coli Colonization in Murine Host by Non-invasive In Vivo Bioluminescence System

A detailed protocol of a mouse model for enterohemorrhagic E. coli (EHEC) colonization by using bioluminescence-labeled bacteria is presented. The detection of these bioluminescent bacteria by a non-invasive in vivo imaging system in live animals can advance our current understanding of EHEC colonization.

Erkennung von Enterohemorrhagic Escherichia Coli Besiedlung in murinen Host durch nicht-invasive In Vivo Biolumineszenz-System

Enterohemorrhagic E. coli (EHEC) O157:H7, which is a foodborne pathogen that causesdiarrhea, hemorrhagic colitis (HS), and hemolytic uremic syndrome ...

Creation of a Dense Transposon Insertion Library Using Bacterial Conjugation in Enterobacterial Strains Such As Escherichia Coli or Shigella flexneri

Transposon mutagenesis is a method that allows gene disruption via the random genomic insertion of a piece of DNA called a transposon. The protocol below outlines a method for high efficiency transfer between bacterial strains of a plasmid harboring a transposon containing a kanamycin resistance marker. The plasmid-borne transposase is encoded by a variant tnp gene that inserts the transposon into the genome of the recipient strain with very low insertional bias. This method thus allows the creation of large mutant libraries in which transposons have been inserted into unique genomic positions in a recipient strain of either Escherichia coli or Shigella flexneri bacteria. By using bacterial conjugation, as opposed to other methods such as electroporation or chemical transformation, large libraries with hundreds of thousands of unique clones can be created. This yields high-density insertion libraries, with insertions occurring as frequently as every 4-6 base pairs in non-essential genes. This method is superior to other methods as it allows for an inexpensive, easy to use, and high efficiency method for the creation of a dense transposon insertion library. The transposon library can be used in downstream applications such as transposon sequencing (Tn-Seq), to infer genetic interaction networks, or more simply, in mutational (forward genetic) screens.

Creation of a Dense Transposon Insertion Library Using Bacterial Conjugation in Enterobacterial Strains Such As Escherichia Coli or Shigella flexneri

Presented here is a simple method for creating a high-density transposon insertion library in Escherichia coli or Shigella flexneri using bacterial conjugation. This protocol allows the creation of a collection of hundreds of thousands of unique mutants in bacteria by the random genomic insertion of a transposon.

Schaffung einer dichten Transposon Insertion Bibliothek verwenden bakterielle Konjugation in Enterobacterial Stämme wie Escherichia Coli oder Shigella flexneri

Transposon mutagenesis is a method that allows gene disruption via the random genomic insertion of a piece of DNA called a transposon. The protocol below ...

Overexpression and Purification of Human Cis-prenyltransferase in Escherichia coli

Prenyltransferases (PT) are a group of enzymes that catalyze chain elongation of allylic diphosphate using isopentenyl diphosphate (IPP) via multiple condensation reactions. DHDDS (dehydrodolichyl diphosphate synthase) is a eukaryotic long-chain cis-PT (forming cis double bonds from the condensation reaction) that catalyzes chain elongation of farnesyl diphosphate (FPP, an allylic diphosphate) via multiple condensations with isopentenyl diphosphate (IPP). DHDDS is of biomedical importance, as a non-conservative mutation (K42E) in the enzyme results in retinitis pigmentosa, ultimately leading to blindness. Therefore, the present protocol was developed in order to acquire large quantities of purified DHDDS, suitable for mechanistic studies. Here, the usage of protein fusion, optimized culture conditions and codon-optimization were used to allow the overexpression and purification of functionally active human DHDDS in E. coli. The described protocol is simple, cost-effective and time sparing. The homology of cis-PT among different species suggests that this protocol may be applied for other eukaryotic cis-PT as well, such as those involved in natural rubber synthesis.

Overexpression and Purification of Human Cis-prenyltransferase in Escherichia coli

A simple protocol for overexpression and purification of codon-optimized, human cis-prenyltransferase, under non-denaturing conditions, from Escherichia coli, is described, along with an enzymatic activity assay. This protocol can be generalized for production of other cis- prenyltransferase proteins in quantity and quality suitable for mechanistic studies.

Überexpression und Reinigung des Menschen<em&gt; Cis</em&gt; -prenyltransferase in<em&gt; Escherichia coli</em

Prenyltransferases (PT) are a group of enzymes that catalyze chain elongation of allylic diphosphate using isopentenyl diphosphate (IPP) via multiple ...

Using Enhanced Green Fluorescence Protein-expressing Escherichia Coli to Assess Mouse Peritoneal Macrophage Phagocytosis

This manuscript describes a simple and reproducible method to perform a phagocytosis assay. The first part of this method involves building a pET-SUMO-EGFP vector (SUMO = small ubiquitin-like modifier) and expressing enhanced green fluorescence protein (EGFP) in Escherichia coli (BL21DE). EGFP-expressing E. coli is coincubated with macrophages for 1 h at 37 &#176;C; the negative control group is incubated on ice for the same amount of time. Then, the macrophages are ready for assessment. The advantages of this technique include its simple and straightforward steps, and phagocytosis can be measured by both flow cytometer and fluorescence microscope. The EGFP-expressing E. coli are stable and display a strong fluorescence signal even after the macrophages are fixed with paraformaldehyde. This method is not only suitable for the assessment of macrophage cell lines or primary macrophages in vitro but also suitable for the evaluation of granulocyte and monocyte phagocytosis in peripheral blood mononuclear cells. The results show that the phagocytic capability of peritoneal macrophages from young (eight-week-old) mice is higher than that of macrophages from aged (16-month-old) mice. In summary, this method measures macrophage phagocytosis and is suitable for studying the innate immune system function.

Using Enhanced Green Fluorescence Protein-expressing Escherichia Coli to Assess Mouse Peritoneal Macrophage Phagocytosis

Here, we present a protocol to assess mouse peritoneal macrophage phagocytosis using enhanced green fluorescence protein-expressing Escherichia coli.