이 작품은 Mitsubishi Foundation, 다케다 과학 재단, JST PRESTO 및 JSPS KAKENHI 부여 번호 16H06144에 의해 지원되었습니다.

모든 실험 절차는 도쿄 대학의 동물 실험 윤리위원회의 승인과 실험실 동물의 관리 및 사용에 대한 도쿄 대학의 지침에 따라 수행되었습니다. 1. 솔루션 준비 <ol><li> 0.01 M 인산염 완충 식염수 (PBS)를 준비합니다 : PBS 정제 (0.14 M NaCl, 0.0027 M KCl, 0.010 M PO 4 3- , pH 7.4)를 증류수 1 L에 넣고 완전히 용해 될 때까지 실온에서 저어줍니다. </li><li> PBS에 4 % 파라 포름 알데히드 (PFA)를 준비합니다 : 100 ML PBS에 4g의 PFA를 추가합니다. 그것이 완전히 녹을 때까지 60 ° C에서 용액을 저어 준다. <ol><li> PBS에 PFA를 용해시킨 후, 1N 수산화 나트륨 (NaOH)으로 용액의 pH를 7.4로 조절한다. 그런 다음 얼음으로 식힌 다음 여과지를 통해 용액을 여과하여 미립자 물질을 제거합니다. 4 ° C에서 보관하십시오. 주의 :이 시약을 사용할 때는 적절한주의를 기울이십시오. 핸들장갑, 안전 안경 및 화학 물질 두건 아래 실험실 코트를 조심스럽게 사용하십시오. 참고 : 2 일 이내에 준비된 신선한 4 % PFA 용액을 사용하십시오. </li></ol></li><li> 0.3 % Triton X - 100 (PBST)가 보충 된 0.01M PBS를 준비하십시오 : PBS의 997 ML에 트리톤 X - 100 3 ML을 추가합니다. 용액이 완전히 녹을 때까지 실온에서 교반하십시오. </li><li> 1 % 및 5 % 블로킹 용액을 준비한다 : 탈지유 10g을 PBST 200mL에 넣고 5 % 블로킹 용액을 만든다. 그것이 완전히 녹을 때까지 실온에서 교반하십시오. PBST로 5 % 블로킹 용액을 5 번 희석하여 1 % 블로킹 용액을 제조한다. </li></ol> 2. Parasagittal OB 섹션의 준비 <ol><li> 1 ~ 2 주령의 동물을 사용하십시오. 사구체가 명확하게 보이고 두개골로 뇌를 절단 할 수 있기 때문에이 연령대는 다음 실험에 적합합니다. </li><li> pentobarbital (50 MG / kg 체중)의 intraperitoneal 주사로 동물을 마취. 얼음 냉 4 % P로 동물을 경련 주사한다.PBS의 FA. 조심해서 다루고 화학 물질 두건 아래에 장갑, 안전 고글 및 실험실 코트를 사용하십시오. </li><li> 관류 후 가위로 머리를 잘라 피부를 조심스럽게 제거하십시오. 그런 다음 가위 칼날을 위턱과 아래턱 사이의 공간에 삽입하고 수평으로 자르면서 아래턱을 제거합니다. OB 및 OE를 포함하여 후각 조직을 떠나려면 집게 및 가위로 과도한 조직을 정리하십시오. 참고 : OB를 둘러싸고있는 두개골을 제거하지 마십시오. 이것은 중간 사구체를 수직으로 똑바로 유지하기 때문에 OB를 둘러싼 두개골을 제거하지 마십시오. </li><li> 비강에있는 공기를 제거하기 위해 PBS에 후각 조직을 담그십시오. 뇌의 후부를 수직으로 잘라 내고 후각 조직을 삽입면의 아래쪽에 삽입하십시오. 몰드에 Optimal Cutting Temperature (OCT) 화합물을 채우고 액체 질소에 몰드를 담그십시오. <ol><li> 화합물에있는 조직이 완전히 얼린 후에, 그것을 cryos에서 품어 라.-20 ℃에서 1 시간 동안 배양한다. </li></ol></li><li> 저온 유지 장치를 사용하여 OB의 직렬 parasagittal 섹션 (10 μm)을 만들고 MAS 코팅 유리 슬라이드에 부착하여 수집하십시오. 붙인 후 즉시 블로 드라이어로 슬라이드를 건조하십시오. </li></ol> 3. 1 일째 : OB 슬라이스의 4 배 Immunostaining <ol><li> RT에서 PBS로 5 분 슬라이드를 씻으십시오. 3 번 반복하십시오. </li><li> 실온에서 5 % 차단 솔루션과 슬라이드를 1 시간 품어 비특이적 인 바인딩 사이트를 차단합니다. </li><li> RT에서 1 % 차단 솔루션의 기본 항체 (각 슬라이드 400 μL)의 칵테일과 O / N 슬라이드를 품어. 기니피그 항 Kirrel2 항체 (1 : 1000), 염소 항 세마포린 -7A (Sema7A) 항체 (1 : 500), 래트 항 -OL- 프로토 커 들린 (OLPC) 항체 (1 : 500) 및 마우스 항 - 소 혈청 글루타메이트 트랜스 포터 2 (VGLUT2) 항체 (1 : 500). </li></ol> 4. 2 일째 : OB의 4 배 Immunostaining조각 <ol><li> 일차 항체 용액을 버리고 RT에서 PBST로 5 분 동안 슬라이드를 씻으십시오. 3 번 반복하십시오. </li><li> RT에서 PBS의 보조 항체 (각 슬라이드 400 μL)의 칵테일과 1 시간 슬라이드를 품어. 당나귀 항 마우스 Alexa Fluor 405 (1 : 400), 당나귀 방제 Alexa Fluor 488 (1 : 400), 당나귀 항 기니아 피그 Alexa Fluor 555 (1 : 400) 및 당나귀 항 - 쥐 Alexa Fluor 647 (1 : 400). 참고 : 모든 2 차 항체는 동일한 숙주에서 유래한다. 파장이 겹치지 않도록 각 1 차 항체에 대한 2 차 항체의 형광 파장을 선택하십시오. </li><li> 솔루션을 폐기하고 RT에서 PBS로 5 분 슬라이드를 씻으십시오. 3 번 반복하십시오. </li><li> 마운트 매체로 슬라이드에 coverslips를 마운트합니다. 이를 위해, 각 슬라이드에 장착 매체 2 방울을 적용한 다음, 기포를 제거하여 coverslip을 넣어. </li></ol> 5. 강도 Me의구심 <ol><li> 형광 현미경으로 형광 이미지를 얻습니다. Alexa Fluor 405 신호, GFP 필터 큐브 (470/40 nm 여기, 525/50 nm 방출, 500 nm 방출, 400 nm 다이크로 익 미러)에 대해 DAPI 필터 큐브 (360/40 nm 여기, 460/50 nm 방사 및 400 nm 다이크로 익 미러) 및 495 nm 다이크로 익 미러), Alexa Fluor 555 용 TRITC 필터 큐브 (545/25 nm 여기, 605/70 nm 방출 및 565 nm 다이크로 익 미러) 및 Cy5 필터 큐브 (620/60 nm 여기, 700 / 75 nm emission, 600 nm dichroic mirror)을 Alexa Fluor 647에 적용했습니다. 참고 : 채도가없는 이미지의 형광 신호를 얻으려면 노출 시간을 조정하십시오. </li><li> VGLUT2의 immunofluorescence 신호로 사구체 구조를 정의하십시오. ImageJ로 사구체 내 축삭 정렬 분자의 염색 강도를 측정합니다. </li></ol> 6. 데이터 분석 <ol><li> 축삭 정렬 분자의 얼룩 강도에서 배경 신호를 뺍니다. </li><li> 준비하기e 발현 데이터 매트릭스는 축삭 정렬 분자로 구성된 컬럼과 사구체로 구성된 행을 갖는다. </li><li> 준비된 표현 데이터 세트를 사용하여 주성분 분석 (PCA)을 수행하십시오. 그런 다음 각 주 구성 요소의 PCA 점수, 기여도 비율 및 요인 부하를 얻습니다. </li></ol>

<ol>
	<li>Mori, K., Sakano, H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=How+is+the+olfactory+map+formed+and+interpreted+in+the+mammalian+brain?.">How is the olfactory map formed and interpreted in the mammalian brain?.</a> Annu Rev Neurosci. 34, 467-499 (2011).</li><li>Takeuchi, H., Sakano, H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Neural+map+formation+in+the+mouse+olfactory+system.">Neural map formation in the mouse olfactory system.</a> Cell Mol Life Sci. 71, 3049-3057 (2014).</li><li>Mombaerts, P., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Visualizing+an+olfactory+sensory+map.">Visualizing an olfactory sensory map.</a> Cell. 87, 675-686 (1996).</li><li>Feinstein, P., Mombaerts, P. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+contextual+model+for+axonal+sorting+into+glomeruli+in+the+mouse+olfactory+system.">A contextual model for axonal sorting into glomeruli in the mouse olfactory system.</a> Cell. 117, 817-831 (2004).</li><li>Ishii, T., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Monoallelic+expression+of+the+odourant+receptor+gene+and+axonal+projection+of+olfactory+sensory+neurones.">Monoallelic expression of the odourant receptor gene and axonal projection of olfactory sensory neurones.</a> Genes Cell. 6, 71-78 (2001).</li><li>Nakashima, A., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Agonist-independent+GPCR+activity+regulates+anterior-posterior+targeting+of+olfactory+sensory+neurons.">Agonist-independent GPCR activity regulates anterior-posterior targeting of olfactory sensory neurons.</a> Cell. 154, 1314-1325 (2013).</li><li>Serizawa, S., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=A+neuronal+identity+code+for+the+odorant+receptor-specific+and+activity-dependent+axon+sorting.">A neuronal identity code for the odorant receptor-specific and activity-dependent axon sorting.</a> Cell. 127, 1057-1069 (2006).</li><li>Kaneko-Goto, T., Yoshihara, S., Miyazaki, H., Yoshihara, Y. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=BIG-2+mediates+olfactory+axon+convergence+to+target+glomeruli.">BIG-2 mediates olfactory axon convergence to target glomeruli.</a> Neuron. 57, 834-846 (2008).</li><li>Ihara, N., Nakashima, A., Hoshina, N., Ikegaya, Y., Takeuchi, H. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Differential+expression+of+axon-sorting+molecules+in+mouse+olfactory+sensory+neurons.">Differential expression of axon-sorting molecules in mouse olfactory sensory neurons.</a> Eur J Neuro. 44, 1998-2003 (2016).</li><li>Williams, E. O., et al. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=Delta+Protocadherin+10+is+Regulated+by+Activity+in+the+Mouse+Main+Olfactory+System.">Delta Protocadherin 10 is Regulated by Activity in the Mouse Main Olfactory System.</a> Front Neural Circuits. 5, 9 (2011).</li><li>Brunet, L. J., Gold, G. H., Ngai, J. <a target="_blank" href="http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Search&doptcmdl=Citation&defaultField=Title+Word&term=General+anosmia+caused+by+a+targeted+disruption+of+the+mouse+olfactory+cyclic+nucleotide-gated+cation+channel.">General anosmia caused by a targeted disruption of the mouse olfactory cyclic nucleotide-gated cation channel.</a> Neuron. 17, 681-693 (1996).</li></ol>

저자는 경쟁적인 금전적 이해 관계가 없음을 선언합니다.

parasagittal OB 섹션의 4 배 면역 염색은 많은 수의 사구체에서 동시에 4 개의 축삭 정렬 분자의 발현 수준을 시각화하고 정량화 할 수있었습니다. 이러한 다변량 데이터를 PCA로 분석함으로써 이들 분자의 발현 특성을 추측 할 수 있습니다. 성공적인 염색을 위해서는 조직 샘플 준비가 매우 중요합니다. 일부 프로토콜은 조직을 4 % PFA로 후 고정시키고 cryoprotection을 위해 30 % sucrose로 치료해야한다고 제안했다. 그러나이 단계는이 프로토콜에서 생략되었습니다. 이는 대부분의 경우 이러한 단계가 염색 신호 강도를 감소시키고 배경을 증가시키기 때문입니다. 또한 염색 중 높은 배경을 피하기 위해 절편을 어느 단계에서나 말려서는 안됩니다. 최적의 염색 조건은 사용되는 조직과 항체의 종류에 따라 다릅니다. 그러므로, 그것은 필연적이다.y를 사용하여 각 실험의 특정 염색 조건을 결정합니다. 또한 1 차 항체의 농도도 중요합니다. 농도가 너무 높으면 배경이 커집니다. 그러나 농도가 너무 낮 으면 신호가 감소합니다. 따라서 고품질의 염색 결과를 얻기 위해 1 차 항체의 적절한 농도를 확인하는 것이 중요합니다. 한 가지 한계는이 방법이 동물 종에 대한 1 차 항체 및 1 차 항체 조합의 품질에 크게 의존한다는 것입니다. OB의 코로널 섹션은 면역 염색을 위해 일상적으로 사용되었습니다. 그러나,이 프로토콜에서는, OB의 내측의 parasagittal 섹션은 단일 섹션에 더 많은 사구체를 배치 할 수 있도록 사용되었습니다. 이 섹션은 배 쪽과 뒤쪽의 축을 따라 사구체의 지형적 인 순서를 유지하기 때문에, 또한 배부 패턴을 분석하는 데 사용할 수 있습니다.OSN 축삭 돌기의 돌출 부위를 결정하는 축삭 유도 분자. 이 연구에서 OB의 parasagittal 섹션은 단일 섹션에 더 많은 사구체를 배치 할 수 있도록 준비되었습니다. 또한 수평 단면은 연구자가 내측 - 외측 또는 전 - 후방 축을 따라 차이를 나타낼 때 유용 할 수 있습니다. 다중 면역 염색을 위해 사용될 수있는 항체의 개발과 함께,이 4 배 염색 방법은 OB뿐만 아니라 다른 뇌 영역에도 적용될 수 있습니다.

개발하는 동안, 뉴런은 서로 정확하게 연결되어 정상적인 뇌 기능에 중요한 적절한 신경 회로를 형성합니다. 뇌의 비정상적인 신경 회로는 자폐증 및 정신 분열증과 같은 정신 장애의 원인으로 여겨지므로 신경 회로 형성 메커니즘을 이해하는 것이 신경 과학 분야의 주요 과제 중 하나입니다. 마우스 후각 시스템에서 Olfactory Epithelium (OE)의 각 감각 신경 세포 (OSN)는 오직 하나의 기능적 후각 수용체 (OR) 유전자를 발현하고 동일한 OR을 발현하는 OSNs는 축색 돌기의 고정 된 위치에서 사구체의 특정 쌍에 축삭을 수렴시킵니다. 후각 망막 (OB) 1 , 2 . 마우스 후각 시스템은 신경 회로 형성의 분자 메커니즘을 연구하기위한 훌륭한 모델 시스템입니다. 연구자는 OR 표현을 활용하여 특정 s를 식별 할 수 있기 때문에OSNs의 ubtype과 명확한 사구체 구조로 OSN axons의 투영 사이트를 시각화. OSN 예측의 주목할만한 특징은 OR이 OSN 축색 돌기를 OB 3 , 4 , 5 , 6 에 투사 할 때 중요한 역할을한다는 점입니다. 보다 구체적으로, OSN 축삭 돌기가 표적 부위를 대략적으로 안내 한 후에, 이들은 분리되어 OR 의존성 방식으로 사구체를 형성한다. 이전의 연구는 OR 분자가 사구체 분리를 조절하는 축삭 정렬 분자의 발현을 조절한다는 것을 보여 주었다. 더욱이 축적 된 증거에 따르면 OR 분자는 축삭 정렬 분자의 독특한 조합에 의해 신경 신원 코드를 생성한다. 따라서, OR 의존성 사구체 분리의 메커니즘을 이해하기 위해서는 axon-sorting mol의 발현 프로파일을 특성화 할 필요가있다OSNs의 ecules. 형광 면역 염색은 특정 유전자의 발현을 시각화하는 일반적인 방법입니다. axon-sorting 분자의 단백질은 주로 OSN 축삭에 국한되어 있기 때문에 연구자들은 OBN을 이용하여 OSN에서의 발현 양상을 분석 할 필요가있다. OB의 관상 절편은 면역 염색에 일상적으로 사용되었습니다. 그러나,이 준비는 같은 OB 섹션에서 전후 축을 따라 지형 정보를 잃습니다. 따라서 우리는 OB의 내측의 parasagittal 준비를 개발했다. 이것은 같은 OB 구역에서 가능한 한 많은 주변 사구를 장착 할 수있다. 여러 항체를 이용한 면역 염색과 결합하여, OB 절 사이의 염색 변이없이 축삭 정렬 분자의 발현 양상을 비교 분석 할 수 있습니다. 또한, 면역 조직 화학 염색 방법은 PFA a와 함께 고정 후 (post-fixation)없이 제시되었다자당 치료. 이 방법을 통해 연구자는 다 변수 데이터 분석을위한 고품질의 염색 데이터를 얻을 수 있습니다. 여기에 제시된 프로토콜은 후각 신경 회로 형성을 연구하는 연구자에게 강력한 방법에 대한 세부 정보를 제공합니다.

<table border="0" cellpadding="0" cellspacing="0" width="713">
	<tbody>
		<tr height="42">
			<td height="42" style="height:42px;width:277px;">Phosphate Buffered Saline (PBS) Tablets, pH7.4</td>
			<td style="width:151px;">TAKARA BIO</td>
			<td style="width:119px;">T9181</td>
			<td style="width:167px;"></td>
		</tr>
		<tr height="42">
			<td height="42" style="height:42px;width:277px;">Skim Milk</td>
			<td style="width:151px;">nacalai tesque</td>
			<td style="width:119px;">31149-75</td>
			<td></td>
		</tr>
		<tr height="42">
			<td height="42" style="height:42px;width:277px;">goat anti-Sema7A antibody</td>
			<td style="width:151px;">R&#38;D Systems</td>
			<td style="width:119px;">AF2068</td>
			<td></td>
		</tr>
		<tr height="42">
			<td height="42" style="height:42px;width:277px;">rat anti-OLPC antibody</td>
			<td style="width:151px;">Merck Millipore</td>
			<td style="width:119px;">MABT20</td>
			<td></td>
		</tr>
		<tr height="42">
			<td height="42" style="height:42px;width:277px;">mouse anti-VGLUT2 antibody</td>
			<td style="width:151px;">Merck Millipore</td>
			<td style="width:119px;">MAB5504</td>
			<td></td>
		</tr>
		<tr height="42">
			<td height="42" style="height:42px;width:277px;">goat anti-BIG-2 antibody</td>
			<td style="width:151px;">R&#38;D Systems</td>
			<td style="width:119px;">AF2205</td>
			<td></td>
		</tr>
		<tr height="168">
			<td height="168" style="height:168px;width:277px;">gunea pig anti-Kirrel2 antibody</td>
			<td style="width:151px;">Operon Biotechnologies</td>
			<td style="width:119px;"></td>
			<td style="width:167px;">Anti-Kirrel2 antibodies were generated by immunizing guinea pigs with KLH-conjugated synthetic peptides (644-673aa): CRLYRARAGYLTTPHPRAFTSYMKPTSFGP</td>
		</tr>
		<tr height="42">
			<td height="42" style="height:42px;width:277px;">donkey anti-mouse Alexa Fluor 405</td>
			<td style="width:151px;">Abcam</td>
			<td style="width:119px;">ab175658</td>
			<td></td>
		</tr>
		<tr height="63">
			<td height="63" style="height:63px;width:277px;">donkey anti-goat Alexa Fluor 488&#160;</td>
			<td style="width:151px;">Jackson ImmunoResearch</td>
			<td style="width:119px;">705-545-003</td>
			<td></td>
		</tr>
		<tr height="63">
			<td height="63" style="height:63px;width:277px;">donkey anti-guinea pig Alexa Fluor 555</td>
			<td style="width:151px;">Thermo Fisher Scientific</td>
			<td style="width:119px;">A21432</td>
			<td></td>
		</tr>
		<tr height="63">
			<td height="63" style="height:63px;width:277px;">donkey anti-rat Alexa Fluor 647</td>
			<td style="width:151px;">Jackson ImmunoResearch</td>
			<td style="width:119px;">712-605-153</td>
			<td></td>
		</tr>
		<tr height="21">
			<td height="21" style="height:21px;width:277px;">Paraformaldehyde</td>
			<td style="width:151px;">Wako</td>
			<td style="width:119px;">162-16065</td>
			<td></td>
		</tr>
		<tr height="42">
			<td height="42" style="height:42px;width:277px;">MAS coated slide glasses</td>
			<td style="width:151px;">MATSUNAMI</td>
			<td style="width:119px;">MAS-01</td>
			<td></td>
		</tr>
		<tr height="63">
			<td height="63" style="height:63px;width:277px;">forceps</td>
			<td style="width:151px;">Fine Science Tools</td>
			<td style="width:119px;">11253-27</td>
			<td></td>
		</tr>
		<tr height="63">
			<td height="63" style="height:63px;width:277px;">Vannas Spring Scissors</td>
			<td style="width:151px;">Fine Science Tools</td>
			<td style="width:119px;">15000-00</td>
			<td></td>
		</tr>
		<tr height="63">
			<td height="63" style="height:63px;width:277px;">dissecting scissors</td>
			<td style="width:151px;">Fine Science Tools</td>
			<td style="width:119px;">14090-09</td>
			<td></td>
		</tr>
		<tr height="21">
			<td height="21" style="height:21px;width:277px;">fluorescent microscope</td>
			<td style="width:151px;">KEYENCE</td>
			<td style="width:119px;">BZ-X700</td>
			<td></td>
		</tr>
		<tr height="21">
			<td height="21" style="height:21px;width:277px;">DAPI filter cube</td>
			<td style="width:151px;">KEYENCE</td>
			<td style="width:119px;">OP-87762</td>
			<td></td>
		</tr>
		<tr height="21">
			<td height="21" style="height:21px;width:277px;">GFP filter cube</td>
			<td style="width:151px;">KEYENCE</td>
			<td style="width:119px;">OP-87763</td>
			<td></td>
		</tr>
		<tr height="21">
			<td height="21" style="height:21px;width:277px;">TRITC filter cube</td>
			<td style="width:151px;">KEYENCE</td>
			<td style="width:119px;">OP-87764</td>
			<td></td>
		</tr>
		<tr height="21">
			<td height="21" style="height:21px;width:277px;">Cy5 filter cube</td>
			<td style="width:151px;">KEYENCE</td>
			<td style="width:119px;">OP-87766</td>
			<td></td>
		</tr>
		<tr height="42">
			<td height="42" style="height:42px;width:277px;">filter paper</td>
			<td style="width:151px;">ADVANTEC</td>
			<td style="width:119px;">00011185</td>
			<td></td>
		</tr>
		<tr height="42">
			<td height="42" style="height:42px;width:277px;">O.C.T compound</td>
			<td style="width:151px;">Sakura Finetek</td>
			<td style="width:119px;">M71484</td>
			<td></td>
		</tr>
	</tbody>
</table>

quadruple immunostaining of the olfactory bulb for visualization of olfactory sensory axon molecular identity codes

마우스 후각 시스템은 간단한 해부학 구조로 인해 신경 회로 형성 메커니즘을 연구하는 데 자주 사용됩니다. 후각 감각 뉴런 (OSN)은 단일 수상 돌기 및 단일 비 축삭 축색 돌기가있는 양극성 세포입니다. OSN은 하나의 후각 수용체 (OR) 유전자 만 발현하며, 주어진 유형의 OR을 표현하는 OSN은 그들의 축색 돌기를 후각 망막 (OB)의 불변성 사구체에 수렴시킵니다. OSN 예측의 두드러진 특징은 표현 된 OR이 축삭 투영에서 중요한 역할을한다는 점입니다. OR는 다중 axon-sorting 분자의 발현을 조절하고 OSN 축삭 말단에서 axon-sorting 분자의 조합 분자 코드를 생성한다. 따라서, OR- 특정 axon 유도 메커니즘의 분자 메커니즘을 이해하기 위해서는 동일한 사구체 내의 OSN 축삭 말단에서 그들의 발현 프로파일을 특성화하는 것이 중요합니다. 이 기사의 목적은 가능한 많은 사구체를 수집하는 방법을 소개하는 것이 었습니다e를 단일 OB 부위에 투여하고 다중 항체를 사용하여 면역 염색을 수행한다. 이것은 OB 절 사이의 얼룩 변이없이 축색 - 정렬 분자의 발현 양상을 비교 분석 할 수있게한다.

후각 사구체지도는 OSN 축삭 1 , 2 의 초기 전역 표적화 및 사후 사구체 분리에 의해 형성됩니다. 사구체 분리는 ax / sorting 분자에 의해 매개되는 접착 성 / 반발 축삭 상호 작용에 의해 조절됩니다.이 분자의 발현 수준은 발현 된 OR 분자에 의해 결정됩니다. 사구체 분리에 관련된 axon-sorting 분자는 OB 9 에서 위치 독립적 인 모자이크 방식으로 표현됩니다. 본 연구에서는 Kirrel2 , Sema7A , OLPC , BIG-2, PCDH17 유전자를 선정 하였다. 이러한 축삭 정렬 분자 중 일부는 활성 의존적 인 방식으로 표현됩니다 ( 7 , 8 , 10) . 4 배 면역여기에 표시된 방법은 동일한 섹션에 동시에 4 개의 분자의 발현 패턴을 시각화 할 수있었습니다. 이러한 axon-sorting 분자는 위치 독립적 인 모자이크 표현을 보였으 나, 그 패턴은 동일하지 않았다 (figure 1A, B ). 사구체 구조는 VGLUT2의 형광 신호에 의해 정의됩니다 ( 그림 2A ). Axon 분류 분자 (Kirrel2, Sema7A, OLPC)는 각 사구체에서 차별적으로 발현되었다; 그러나 사구체 마커로 사용 된 VGLUT2는 사구체 사이에서 균일하게 발현되었다 ( 그림 2B, 2C ). 단일 사구체는 여러 변수로 표현되는 데이터 단위로 간주 될 수 있습니다. 이 다 변수 표현 데이터를 분석하기 위해 PCA (Principal Component Analysis)가 수행되었습니다. PCA는 새로운 좌표계를 정의하므로 첫 번째 좌표가 가장 큰 분산 데이터 세트를 가지며 각 좌표계좌표의 잔차 분산이 가장 큽니다. 발현 데이터 세트는 PCA를 거치며 제 1 및 제 2 주성분 (PC1 및 PC2)의 공간에 그려졌다 ( 도 3A ). 각 주성분의 기여 비율은 각 주성분이 변수의 전체 경향에서 얼마나 많은 비율을 나타내는지를 나타냅니다. PC1, PC2, PC3, PC4, PC5의 기여율은 각각 33.4 %, 28.2 %, 19.8 %, 17.3 %, 6.3 %였다 ( 그림 3B ). 또한 PCA는 각 주성분에 요인 적재량을 나타냈다. 제곱 팩터 로딩은 원래 변수의 분산 중 비율이 요인에 의해 설명되는 정도를 나타냅니다. PC1에서 Sema7A, OLPC 및 Kirrel2의 인자 부하는 양성 이었지만 BIG-2 및 PCDH17의 인자 부하는 그렇지 않았다 ( 그림 3C ). 이전 연구는 cyclic nucleoti가 결핍 된 돌연변이 마우스에서 이들 분자의 발현을 분석했다<html> 후각 신호 전달 11 의 구성 요소 인 degated (CNG) 채널 유전자의 발현 정도를 조사한 결과 CNG 의존성 발현 양상은 PC1 9 의 인자 부하량과 유사 함을 보였다. 이러한 결과는 이들 분자의 다양한 발현이 CNG 채널 매개 신경 활동에 의해 생성되었음을 시사한다. <img alt="그림 1" class="xfigimg" src="/files/ftp_upload/55893/55893fig1.jpg" /> 그림 1 : Parasagittal OB 섹션의 Quadruple Immunostaining. ( A ) OE &amp; OB의 개략도. ( B ) v GLUT2 (흰색), Kirrel2 (빨간색), Sema7A (녹색) 및 OLPC (파란색)에 대한 항체로 immunostained 2 주 된 마우스의 parasagittal OB 섹션. Kirrel2 (빨간색), Sema7A (녹색) 및 OLPC (파란색)의 병합 된 이미지가 오른쪽에 표시되었습니다. 스케일 바 = 100 μm./files/ftp_upload/55893/55893fig1large.jpg &quot;target =&quot;_ blank &quot;&gt;이 그림의 더 큰 버전을 보려면 여기를 클릭하십시오. <img alt="그림 2" class="xfigimg" src="/files/ftp_upload/55893/55893fig2.jpg" /> 그림 2 : Axon 정렬 분자의 발현 분석. ( A ) VGLUT2 (자주색), Kirrel2 (적색), Sema7A (녹색) 및 OLPC (파란색)에 대한 항체로 immunostained parasagittal 후각 전구 (OB) 섹션. 각 사구체는 VGLUT2의 형광 신호 (사전 시냅스 마커)에 의해 정의됩니다. 사구체 구조는 점선으로 둘러싸여 있습니다. ( B ) 사구체 # 1, # 3, # 4 및 # 6에서의 Kirrel2, Sema7A 및 OLPC의 발현 수준. 축삭 정렬 분자의 염색 강도는 각 사구체에서 측정되었다. ( C ) 사구체 사이의 축삭 정렬 분자와 VGLUT2의 발현 수준 비교. 이들 분자의 신호 강도는 each glomerulus. 그래프의 회색 막대는 발현 수준의 평균을 나타냅니다. 스케일 바 = 100 μm. <a href="https://ecsource-jove-com.remotexs.ntu.edu.sg/files/ftp_upload/55893/55893fig2large.jpg" target="_blank">이 그림의 더 큰 버전을 보려면 여기를 클릭하십시오.</a> <img alt="그림 3" class="xfigimg" src="/files/ftp_upload/55893/55893fig3.jpg" /> 그림 3 : Axon 정렬 분자의 발현 데이터의 PCA. ( A ) 5 개의 축삭 - 정렬 분자 (Kirrel2, Sema7A, OLPC, BIG-2 및 PCDH17)의 발현 데이타 세트의 주성분 분석 (PCA) 스코어 biplots (PC1 대 PC2). 총 1799 개의 사구체를 분석했습니다. ( B ) 다섯 가지 주요 구성 요소의 기여 비율 및 누적 기여 비율. PC1, PC2, PC3, PC4 및 PC5의 기여 비율은 각각 0.334, 0.282, 0.198, 0.173 및 0.063입니다. ( C ) Kirrel의 요인 적재량2, Sema7A, OLPC, BIG-2 및 PCDH17을 사용합니다. PC1, PC2 및 PC3의 고유 값은 각각 1.67, 1.16 및 0.99입니다. <a href="https://ecsource-jove-com.remotexs.ntu.edu.sg/files/ftp_upload/55893/55893fig3large.jpg" target="_blank">이 그림의 더 큰 버전을 보려면 여기를 클릭하십시오.</a>

Watch this Scientific Journal Video about Quadruple Immunostaining of the Olfactory Bulb for Visualization of Olfactory Sensory Axon Molecular Identity Codes at JoVE.com

Quadruple Immunostaining of the Olfactory Bulb for Visualization of Olfactory Sensory Axon Molecular Identity Codes

후각 감각 뉴런은 적절한 신경 회로를 만들기 위해 다양한 축삭 정렬 분자를 발현합니다. 이 프로토콜은 후각 감각 뉴런의 축삭 종말에 축삭 - 정렬 분자의 조합 표현을 시각화하기 위해 면역 조직 화학 염색법을 설명합니다.

후각 감각 축색 돌연변이 분자 식별 코드의 시각화를위한 뒷 전구의 4 배 면역 면역 측정법

The mouse olfactory system is often used to study mechanisms of neural circuit formation&#12288;because of its simple anatomical structure. An Olfactory ...

quadruple-immunostaining-olfactory-bulb-for-visualization-olfactory

Nanyang Technological University

Research

JoVE Journal

Neuroscience

7.0K 조회수.  The University of Tokyo.  후각 감각 뉴런은 적절한 신경 회로를 만들기 위해 다양한 축삭 정렬 분자를 발현합니다. 이 프로토콜은 후각 감각 뉴런의 축삭 종말에 축삭 - 정렬 분자의 조합 표현을 시각화하기 위해 면역 조직 화학 염색법을 설명합니다. 

비디오: Quadruple Immunostaining of the Olfactory Bulb for Visualization of Olfactory Sensory Axon Molecular Identity Codes

Analyzing Responses of Mouse Olfactory Sensory Neurons Using the Air-phase Electroolfactogram Recording

Animals depend on olfaction for many critical behaviors, such as finding food sources, avoiding predators, and identifying conspecifics for mating and other social interactions. The electroolfactogram (EOG) recording is an informative, easy to conduct, and reliable method to assay olfactory function at the level of the olfactory epithelium. Since the 1956 description of the EOG by Ottoson in frogs1, the EOG recording has been applied in many vertebrates including salamanders, rabbits, rats, mice, and humans (reviewed by Scott and Scott-Johnson, 2002, ref. 2). The recent advances in genetic modification in mice have rekindled interest in recording the EOG for physiological characterization of olfactory function in knock-out and knock-in mice. EOG recordings have been successfully applied to demonstrate the central role of olfactory signal transduction components3-8, and more recently to characterize the contribution of certain regulatory mechanisms to OSN responses9-12.
Odorant detection occurs at the surface of the olfactory epithelium on the cilia of OSNs, where a signal transduction cascade leads to opening of ion channels, generating a current that flows into the cilia and depolarizes the membrane13. The EOG is the negative potential recorded extracellularly at the surface of the olfactory epithelium upon odorant stimulation, resulting from a summation of the potential changes caused by individual responsive OSNs in the recording field2. Comparison of the amplitude and kinetics of the EOG thus provide valuable information about how genetic modification and other experimental manipulations influence the molecular signaling underlying the OSN response to odor. 
Here we describe an air-phase EOG recording on a preparation of mouse olfactory turbinates. Briefly, after sacrificing the mouse, the olfactory turbinates are exposed by bisecting the head along the midline and removing the septum. The turbinate preparation is then placed in the recording setup, and a recording electrode is placed at the surface of the olfactory epithelium on one of the medial turbinates. A reference electrode is electrically connected to the tissue through a buffer solution. A continuous stream of humidified air is blown over the surface of the epithelium to keep it moist. The vapor of odorant solutions is puffed into the stream of humidified air to stimulate the epithelium. Responses are recorded and digitized for further analysis.

The electroolfactogram (EOG) recording is an informative, easy-to-conduct, and reliable way of assessing olfactory function at the level of the olfactory epithelium. This protocol describes a recording setup, mouse tissue preparation, data collection, and basic data analysis.

에어 - 상 Electroolfactogram 기록을 사용하여 마우스 강한 감각 뉴런의 분석 응답

Animals depend on olfaction for many critical behaviors, such as finding food sources, avoiding predators, and identifying conspecifics for mating and ...

연구

신경과학

Isolating Nasal Olfactory Stem Cells from Rodents or Humans

The olfactory mucosa, located in the nasal cavity, is in charge of detecting odours. It is also the only nervous tissue that is exposed to the external environment and easily accessible in every living individual. As a result, this tissue is unique for anyone aiming to identify molecular anomalies in the pathological brain or isolate adult stem cells for cell therapy. 
Molecular abnormalities in brain diseases are often studied using nervous tissue samples collected post-mortem. However, this material has numerous limitations. In contrast, the olfactory mucosa is readily accessible and can be biopsied safely without any loss of sense of smell1. Accordingly, the olfactory mucosa provides an "open window" in the adult human through which one can study developmental (e.g. autism, schizophrenia)2-4 or neurodegenerative (e.g. Parkinson, Alzheimer) diseases4,5. Olfactory mucosa can be used for either comparative molecular studies4,6 or in vitro experiments on neurogenesis3,7.
The olfactory epithelium is also a nervous tissue that produces new neurons every day to replace those that are damaged by pollution, bacterial of viral infections. This permanent neurogenesis is sustained by progenitors but also stem cells residing within both compartments of the mucosa, namely the neuroepithelium and the underlying lamina propria8-10. We recently developed a method to purify the adult stem cells located in the lamina propria and, after having demonstrated that they are closely related to bone marrow mesenchymal stem cells (BM-MSC), we named them olfactory ecto-mesenchymal stem cells (OE-MSC)11.
Interestingly, when compared to BM-MSCs, OE-MSCs display a high proliferation rate, an elevated clonogenicity and an inclination to differentiate into neural cells. We took advantage of these characteristics to perform studies dedicated to unveil new candidate genes in schizophrenia and Parkinson's disease4. We and others have also shown that OE-MSCs are promising candidates for cell therapy, after a spinal cord trauma12,13, a cochlear damage14 or in an animal models of Parkinson's disease15 or amnesia16.
In this study, we present methods to biopsy olfactory mucosa in rats and humans. After collection, the lamina propria is enzymatically separated from the epithelium and stem cells are purified using an enzymatic or a non-enzymatic method. Purified olfactory stem cells can then be either grown in large numbers and banked in liquid nitrogen or induced to form spheres or differentiated into neural cells. These stem cells can also be used for comparative omics (genomic, transcriptomic, epigenomic, proteomic) studies.

We describe here a method for biopsying olfactory mucosa from rat and human nasal cavities. These biopsies can be used for either identifying molecular anomalies in brain diseases or isolating multipotent adult stem cells that can be utilized for cell transplantation in animal models of brain trauma/disease.

설치류 또는 인간의 네이절 강한 줄기 세포를 분리

The olfactory mucosa, located in the nasal cavity, is in charge of detecting odours. It is also the only nervous tissue that is exposed to the external ...

Lentivirus-mediated Genetic Manipulation and Visualization of Olfactory Sensory Neurons in vivo

Development of a precise olfactory circuit relies on accurate projection of olfactory sensory neuron (OSN) axons to their synaptic 
targets in the olfactory bulb (OB). The molecular mechanisms of OSN axon growth and targeting are not well understood. Manipulating gene expression and subsequent 
visualizing of single OSN axons and their terminal arbor morphology have thus far been challenging. To study gene function at the single cell level within a specified 
time frame, we developed a lentiviral based technique to manipulate gene expression in OSNs in vivo. Lentiviral particles are delivered to OSNs by microinjection 
into the olfactory epithelium (OE). Expression cassettes are then permanently integrated into the genome of transduced OSNs. Green fluorescent protein expression 
identifies infected OSNs and outlines their entire morphology, including the axon terminal arbor. Due to the short turnaround time between microinjection and 
reporter detection, gene function studies can be focused within a very narrow period of development. With this method, we have detected GFP expression within as 
few as three days and as long as three months following injection. We have achieved both over-expression and shRNA mediated knock-down by lentiviral microinjection. 
This method provides detailed morphologies of OSN cell bodies and axons at the single cell level in vivo, and thus allows characterization of candidate gene function 
during olfactory development.

Lentivirus-mediated Genetic Manipulation and Visualization of Olfactory Sensory Neurons in vivo

We present a lentiviral technique for genetic manipulation and visualization of single olfactory sensory neuron axon and its terminal arborization in vivo.

강한 감각 뉴런의 Lentivirus - 중재 유전자 조작 및 시각화 생체내에</em

Development of a precise olfactory circuit relies on accurate projection of olfactory sensory neuron (OSN) axons to their synaptic 
targets in the ...

Targeting Olfactory Bulb Neurons Using Combined In Vivo Electroporation and Gal4-Based Enhancer Trap Zebrafish Lines

In vivo electroporation is a powerful method for delivering DNA expression plasmids, RNAi reagents, and morpholino anti-sense oligonucleotides to specific regions of developing embryos, including those of C. elegans, chick, Xenopus, zebrafish, and mouse 1. In zebrafish, in vivo electroporation has been shown to have excellent spatial and temporal resolution for the delivery of these reagents 2-7. The temporal resolution of this method is important because it allows for incorporation of these reagents at specific stages in development. Furthermore, because expression from electroporated vectors occurs within 6 hours 7, this method is more timely than transgenic approaches. While the spatial resolution can be extremely precise when targeting a single cell 2, 6, it is often preferable to incorporate reagents into a specific cell population within a tissue or structure. When targeting multiple cells, in vivo electroporation is efficient for delivery to a specific region of the embryo; however, particularly within the developing nervous system, it is difficult to target specific cell types solely through spatially discrete electroporation. Alternatively, enhancer trap transgenic lines offer excellent cell type-specific expression of transgenes 8. Here we describe an approach that combines transgenic Gal4-based enhancer trap lines 8 with spatially discrete in vivo electroporation 7, 9 to specifically target developing neurons of the zebrafish olfactory bulb. The Et(zic4:Gal4TA4,UAS:mCherry)hzm5 (formerly GA80_9) enhancer trap line previously described 8, displays targeted transgenic expression of mCherry mediated by a zebrafish optimized Gal4 (KalTA4) transcriptional activator in multiple regions of the developing brain including hindbrain, cerebellum, forebrain, and the olfactory bulb. To target GFP expression specifically to the olfactory bulb, a plasmid with the coding sequence of GFP under control of multiple Gal4 binding sites (UAS) was electroporated into the anterior end of the forebrain at 24-28 hours post-fertilization (hpf). Although this method incorporates plasmid DNA into multiple regions of the forebrain, GFP expression is only induced in cells transgenically expressing the KalTA4 transcription factor. Thus, by using the GA080_9 transgenic line, this approach led to GFP expression exclusively in the developing olfactory bulb. GFP expressing cells targeted through this approach showed typical axonal projections, as previously described for mitral cells of the olfactory bulb 10. This method could also be used for targeted delivery of other reagents including short-hairpin RNA interference expression plasmids, which would provide a method for spatially and temporally discrete loss-of-function analysis.

Targeting Olfactory Bulb Neurons Using Combined In Vivo Electroporation and Gal4-Based Enhancer Trap Zebrafish Lines

The temporal and spatial resolution of genetic manipulations determines the spectrum of biological phenomena that they can perturb. Here we use temporally and spatially discrete in vivo electroporation, combined with transgenic lines of zebrafish, to induce expression of a GFP transgene specifically in neurons of the developing olfactory bulb.

결합을 사용하여 타겟팅 후각 망울의 뉴런 VIVO에서 Electroporation 및 Gal4 기반 향상제 트랩 Zebrafish 라인

In vivo electroporation is a powerful method for delivering DNA expression plasmids, RNAi reagents, and morpholino anti-sense oligonucleotides to specific ...

Flash Photolysis of Caged Compounds in the Cilia of Olfactory Sensory  Neurons

Photolysis of caged compounds allows the production of rapid and localized increases in the concentration of various physiologically active compounds1. Caged compounds are molecules made physiologically inactive by a chemical cage that can be broken by a flash of ultraviolet light. Here, we show how to obtain patch-clamp recordings combined with photolysis of caged compounds for the study of olfactory transduction in dissociated mouse olfactory sensory neurons. The process of olfactory transduction (Figure 1) takes place in the cilia of olfactory sensory neurons, where odorant binding to receptors leads to the increase of cAMP that opens cyclic nucleotide-gated (CNG) channels2. Ca entry through CNG channels activates Ca-activated Cl channels. We show how to dissociate neurons from the mouse olfactory epithelium3 and how to activate CNG channels or Ca-activated Cl channels by photolysis of caged cAMP4 or caged Ca5. We use a flash lamp6,7 to apply ultraviolet flashes to the ciliary region to uncage cAMP or Ca while patch-clamp recordings are taken to measure the current in the whole-cell voltage-clamp configuration8-11.

Photolysis of caged compounds allows the production of rapid and localized increases in the concentration of various physiologically active compounds. Here, we show how to obtain patch-clamp recordings combined with photolysis of caged cAMP or caged Ca for the study of olfactory transduction in dissociated mouse olfactory sensory neurons.

강한 감각 뉴런의 속눈썹에 갇힌 화합물의 플래시 광분해

Photolysis of caged compounds allows the production of rapid and localized increases in the concentration of various physiologically active compounds1. ...

Imaging Odor-Evoked Activities in the Mouse Olfactory Bulb using Optical Reflectance and Autofluorescence Signals

In the brain, sensory stimulation activates distributed populations of neurons among functional modules which participate to the coding of the stimulus. Functional optical imaging techniques are advantageous to visualize the activation of these modules in sensory cortices with high spatial resolution. In this context, endogenous optical signals that arise from molecular mechanisms linked to neuroenergetics are valuable sources of contrast to record spatial maps of sensory stimuli over wide fields in the rodent brain.
Here, we present two techniques based on changes of endogenous optical properties of the brain tissue during activation. First the intrinsic optical signals (IOS) are produced by a local alteration in red light reflectance due to: (i) absorption by changes in blood oxygenation level and blood volume (ii) photon scattering. The use of in vivo IOS to record spatial maps started in the mid 1980's with the observation of optical maps of whisker barrels in the rat and the orientation columns in the cat visual cortex1. IOS imaging of the surface of the rodent main olfactory bulb (OB) in response to odorants was later demonstrated by Larry Katz's group2. The second approach relies on flavoprotein autofluorescence signals (FAS) due to changes in the redox state of these mitochondrial metabolic intermediates. More precisely, the technique is based on the green fluorescence due to oxidized state of flavoproteins when the tissue is excited with blue light. Although such signals were probably among the first fluorescent molecules recorded for the study of brain activity by the pioneer studies of Britton Chances and colleagues3, it was not until recently that they have been used for mapping of brain activation in vivo. FAS imaging was first applied to the somatosensory cortex in rodents in response to hindpaw stimulation by Katsuei Shibuki's group4.
The olfactory system is of central importance for the survival of the vast majority of living species because it allows efficient detection and identification of chemical substances in the environment (food, predators). The OB is the first relay of olfactory information processing in the brain. It receives afferent projections from the olfactory primary sensory neurons that detect volatile odorant molecules. Each sensory neuron expresses only one type of odorant receptor and neurons carrying the same type of receptor send their nerve processes to the same well-defined microregions of &tilde;100&mu;m3 constituted of discrete neuropil, the olfactory glomerulus (Fig. 1). In the last decade, IOS imaging has fostered the functional exploration of the OB5, 6, 7 which has become one of the most studied sensory structures. The mapping of OB activity with FAS imaging has not been performed yet.
Here, we show the successive steps of an efficient protocol for IOS and FAS imaging to map odor-evoked activities in the mouse OB.

This article presents the protocols of intrinsic optical signals and flavoproteins autofluorescence signals imaging to map odor-evoked activities at the surface of the olfactory bulb in mice.

광 반사율과 Autofluorescence 신호를 사용하여 마우스 후각 망울에서 이미징 냄새 Evoked 활동

In the brain, sensory stimulation activates distributed populations of neurons among functional modules which participate to the coding of the stimulus. ...

A Molecular Readout of Long-term Olfactory Adaptation in C. elegans

During sustained stimulation most sensory neurons will adapt their response by decreasing their sensitivity to the signal. The adaptation response helps shape attention and also protects cells from over-stimulation. Adaptation within the olfactory circuit of C. elegans was first described by Colbert and Bargmann1,2. Here, the authors defined parameters of the olfactory adaptation paradigm, which they used to design a genetic screen to isolate mutants defective in their ability to adapt to volatile odors sensed by the Amphid Wing cells type C (AWC) sensory neurons. When wildtype C. elegans animals are exposed to an attractive AWC-sensed odor3 for 30 min they will adapt their responsiveness to the odor and will then ignore the adapting odor in a chemotaxis behavioral assay for ~1 hr. When wildtype C. elegans animals are exposed to an attractive AWC-sensed odor for ~1 hr they will then ignore the adapting odor in a chemotaxis behavioral assay for ~3 hr. These two phases of olfactory adaptation in C. elegans were described as short-term olfactory adaptation (induced after 30 min odor exposure), and long-term olfactory adaptation (induced after 60 min odor exposure). Later work from L'Etoile et al.,4 uncovered a Protein Kinase G (PKG) called EGL-4 that is required for both the short-term and long-term olfactory adaptation in AWC neurons. The EGL-4 protein contains a nuclear localization sequence that is necessary for long-term olfactory adaptation responses but dispensable for short-term olfactory adaptation responses in the AWC4. By tagging EGL-4 with a green fluorescent protein, it was possible to visualize the localization of EGL-4 in the AWC during prolonged odor exposure. Using this fully functional GFP-tagged EGL-4 (GFP::EGL-4) molecule we have been able to develop a molecular readout of long-term olfactory adaptation in the AWC5. Using this molecular readout of olfactory adaptation we have been able to perform both forward and reverse genetic screens to identify mutant animals that exhibit defective subcellular localization patterns of GFP::EGL-4 in the AWC6,7. Here we describe: 1) the construction of GFP::EGL-4 expressing animals; 2) the protocol for cultivation of animals for long-term odor-induced nuclear translocation assays; and 3) the scoring of the long-term odor-induced nuclear translocation event and recovery (re-sensitization) from the nuclear GFP::EGL-4 state.

A Molecular Readout of Long-term Olfactory Adaptation in C. elegans

Here we describe a molecular readout of long-term olfactory adaptation in Caenorhabditis elegans. The Protein Kinase G, EGL-4, is necessary for stable adaptation responses in the primary sensory neuron pair called AWC. During prolonged odor exposure EGL-4 translocates from the cytosol to nucleus of the AWC.

의 장기 강한 적응의 분자 판독<em&gt; C. elegans</em

During sustained stimulation most sensory neurons will adapt their response by decreasing their sensitivity to the signal. The adaptation response helps ...

Whole Mount Immunolabeling of Olfactory Receptor Neurons in the Drosophila Antenna

Odorant molecules bind to their target receptors in a precise and coordinated manner. Each receptor recognizes a specific signal and relays this information to the brain. As such, determining how olfactory information is transferred to the brain, modifying both perception and behavior, merits investigation. Interestingly, there is emerging evidence that cellular transduction and transcriptional factors are involved in the diversification of olfactory receptor neuron. Here we provide a robust whole mount immunological labeling method to assay in vivo olfactory receptor neuron organization. Using this method, we identified all olfactory receptor neurons with anti-ELAV antibody, a known pan-neural marker and Or49a-mCD8::GFP, an olfactory receptor neuron specifically expressed in Nba neuron using anti-GFP antibody.

Whole Mount Immunolabeling of Olfactory Receptor Neurons in the Drosophila Antenna

Herein we describe the process of whole mount immunostaining of Drosophila antennae, which enables us to better understand the molecular mechanisms involved in the diversification of olfactory receptor neurons (ORN)s.

에있는 후각 수용체 뉴런의 전체 마운트 Immunolabeling<em&gt; 초파리</em&gt; 안테나

Odorant molecules bind to their target receptors in a precise and coordinated manner. Each receptor recognizes a specific signal and relays this ...

Olfactory Assays for Mouse Models of Neurodegenerative Disease

In many neurodegenerative diseases and particularly in Parkinson&#8217;s disease, deficits in olfaction are reported to occur early in the disease process and may be a useful behavioral marker for early detection. Earlier detection in neurodegenerative disease is a major goal in the field because this is when neuroprotective therapies have the best potential to be effective. Therefore, in preclinical studies testing novel neuroprotective strategies in rodent models of neurodegenerative disease, olfactory assessment could be highly useful in determining therapeutic potential of compounds and translation to the clinic. In the present study we describe a battery of olfactory assays that are useful in measuring olfactory function in mice. The tests presented in this study were chosen because they measure olfaction abilities in mice related to food odors, social odors, and non-social odors. These tests have proven useful in characterizing novel genetic mouse models of Parkinson&#8217;s disease as well as in testing potential disease-modifying therapies.

Impairment in olfactory function is a common feature in many neurodegenerative disorders including Parkinson, Alzheimer, and Huntington diseases. In the present article, we describe a set of tests for assessing olfaction discrimination and detection in mice that can be used to measure olfactory abilities in mouse models of neurodegenerative diseases.

신경 퇴행성 질환의 마우스 모델에 대한 후각 분석 실험

In many neurodegenerative diseases and particularly in Parkinson&#8217;s disease, deficits in olfaction are reported to occur early in the disease process ...

Ex Vivo Preparations of the Intact Vomeronasal Organ and Accessory Olfactory Bulb

The mouse accessory olfactory system (AOS) is a specialized sensory pathway for detecting nonvolatile social odors, pheromones, and kairomones. The first neural circuit in the AOS pathway, called the accessory olfactory bulb (AOB), plays an important role in establishing sex-typical behaviors such as territorial aggression and mating. This small (&#60;1 mm3) circuit possesses the capacity to distinguish unique behavioral states, such as sex, strain, and stress from chemosensory cues in the secretions and excretions of conspecifics. While the compact organization of this system presents unique opportunities for recording from large portions of the circuit simultaneously, investigation of sensory processing in the AOB remains challenging, largely due to its experimentally disadvantageous location in the brain. Here, we demonstrate a multi-stage dissection that removes the intact AOB inside a single hemisphere of the anterior mouse skull, leaving connections to both the peripheral vomeronasal sensory neurons (VSNs) and local neuronal circuitry intact. The procedure exposes the AOB surface to direct visual inspection, facilitating electrophysiological and optical recordings from AOB circuit elements in the absence of anesthetics. Upon inserting a thin cannula into the vomeronasal organ (VNO), which houses the VSNs, one can directly expose the periphery to social odors and pheromones while recording downstream activity in the AOB. This procedure enables controlled inquiries into AOS information processing, which can shed light on mechanisms linking pheromone exposure to changes in behavior.

Ex Vivo Preparations of the Intact Vomeronasal Organ and Accessory Olfactory Bulb

The mouse accessory olfactory bulb (AOB) has been difficult to study in the context of sensory coding. Here, we demonstrate a dissection that produces an ex vivo preparation in which AOB neurons remain functionally connected to their peripheral inputs, facilitating research into information processing of mouse pheromones and kairomones.

본래 Vomeronasal 기관 및 액세서리 후각 망울의 생체 준비

The mouse accessory olfactory system (AOS) is a specialized sensory pathway for detecting nonvolatile social odors, pheromones, and kairomones. The first ...